Dataset for protein BCL-2-like of organism Chelonoidis abingdonii

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0G2Q6_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSPNLSPPPATG
A0A8C0IVL6_BCL2L1-      ------MSNTNRELVIDFLSYKLSQRGYSWSRFEGEDEIRTD--------
A0A8C0G393_BCL2A1-      --------------------------------------MESSEYCYVYYL
A0A8C0GRW6_MCL1-01      -----------------------------HVGVKAERGDRLNLYCGGGHA
                                                                 .        

A0A8C0G2Q6_BCL2-01      TSSDHAGLVSLPPEPPG----------SAAASNVPLGDGLHPAPQAVLLA
A0A8C0IVL6_BCL2L1-      -SAEEAEMASVPNGSPSWHPGASHIVNGAAGHSNSLEAHERVPATGVRQA
A0A8C0G393_BCL2A1-      VQDYLKYILQEPQLGPA-----------------PS---------RVAHV
A0A8C0GRW6_MCL1-01      APSAPASPAARGPLRPG-----------------PAEEGRAPRMEKALET
                                       *.                 .           .  .

A0A8C0G2Q6_BCL2-01      LCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGRF-VAVVEELFRDGV-NW
A0A8C0IVL6_BCL2L1-      LREAGDEFELRYRRAFSDLTSQLHITPGTAYQSF-EQVVNELFRDGV-NW
A0A8C0G393_BCL2A1-      LRHAASFLQKENEESLKPCLDTLDITSVDAARRIFTQVMDKEFADGNTNW
A0A8C0GRW6_MCL1-01      LRRVGDGVIEKHQIAFQGMLRKLDIKNEDDLKSV-TAVATHVFSDGVTNW
                        *  ... .       :      * :.       .   *    * **  **

A0A8C0G2Q6_BCL2-01      GRIVAFFEFGGVMCVESVNREMS---PLVDSIAVWMTEYLNRHLHNWIQD
A0A8C0IVL6_BCL2L1-      GRIVAFFSFGGALCVESVDKEMQ---VLVGRIVSWMTTYLTDHLDPWIQE
A0A8C0G393_BCL2A1-      GRILTIFMFGGIISKKLQEHRVQLTGENKKQISYFITEYIINTKAEWIEA
A0A8C0GRW6_MCL1-01      GRIVTLISFGAFVAKHLKSINQE---NCINTLAGIITDVLVTGKRDWLVN
                        ***:::: **. :.    .   .        :   :*  :      *:  

A0A8C0G2Q6_BCL2-01      NGGWD-AFVELYG-------RNMRPVFDFSWISLKTILSLALVGACITLG
A0A8C0IVL6_BCL2L1-      NGGWE-RFVDLYGNDAAAKSRKGQEQFN------RWLLTGATLAGVLLLG
A0A8C0G393_BCL2A1-      NGGWENGFLTMF--------EEKRSWLSLFNIKAKIMDAFSFFSQYY---
A0A8C0GRW6_MCL1-01      QRGWE-GFVEFF--------RVE-------DLEGSIRNVLVAFAGFAGLG
                        : **:  *: ::                              ..      

A0A8C0G2Q6_BCL2-01      AYLGHK--
A0A8C0IVL6_BCL2L1-      SLLSRK--
A0A8C0G393_BCL2A1-      --------
A0A8C0GRW6_MCL1-01      ASLAYMMR
                                

© 1998-2022Legal notice