Dataset for protein BCL-2-like of organism Chelonoidis abingdonii

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C0G2Q6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Chelonoidis abingdonii GN=BCL-2 (length=233 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSPNLSPPPATGTSSDHAGLVSLPPEPPGSAAASNVPLGDGL
HPAPQAVLLALCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDSIAVWMTEYLNRHLHNWIQDNGGWDAFVELYGRNMRPVFDFSWISLKTILSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C0G393_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Chelonoidis abingdonii GN=BCL2A1 (length=175 residues).
MESSEYCYVYYLVQDYLKYILQEPQLGPAPSRVAHVLRHAASFLQKENEESLKPCLDTLDITSVDAARRIFTQVMDKEFA
DGNTNWGRILTIFMFGGIISKKLQEHRVQLTGENKKQISYFITEYIINTKAEWIEANGGWENGFLTMFEEKRSWLSLFNI
KAKIMDAFSFFSQYY
>gnl|bcl2dbpro|A0A8C0GRW6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Chelonoidis abingdonii GN=MCL-1 (length=192 residues).
HVGVKAERGDRLNLYCGGGHAAPSAPASPAARGPLRPGPAEEGRAPRMEKALETLRRVGDGVIEKHQIAFQGMLRKLDIK
NEDDLKSVTAVATHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQENCINTLAGIITDVLVTGKRDWLVNQRGWEGFVEF
FRVEDLEGSIRNVLVAFAGFAGLGASLAYMMR
>gnl|bcl2dbpro|A0A8C0IVL6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Chelonoidis abingdonii GN=BCL2L1 (length=229 residues).
MSNTNRELVIDFLSYKLSQRGYSWSRFEGEDEIRTDSAEEAEMASVPNGSPSWHPGASHIVNGAAGHSNSLEAHERVPAT
GVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAKSRKGQEQFNRWLLTGATLAGVLLLGSLLSRK
© 1998-2022Legal notice