Dataset for protein BCL-2-like of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5LXU8_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A2K5MZX9_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLR----
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      ----------------------------MSQSNRELVVDFLSYKLS----
A0A2K5NZS5_BCL2-01      ----------------------MAHAGRTGYDNREIVMKYIHYKLS----
A0A2K5KHH8_BCL2A1-      -----------------------MTDCEFGYIYR-LAQDYLQYVLQ----
A0A2K5KHH8_BCL2A1-      -----------------------MTDCEFGYIYR-LAQDYLQYVLQ----
A0A2K5LXU8_MCL1-03      -----------------------------------MFGLKRNAVIG----
A0A2K5MMZ4_BCL2L10      -----------------------MADPLRERTER-LLADYLG--------
A0A2K5MZX9_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLR----
                                                                          

A0A2K5LXU8_MCL1-01      GEAGT----------VIGGSAGASPPAALTPDARRVARPPPIGAEVPDVT
A0A2K5MZX9_BCL2L2-      -QKGY----------VCGAGPG----------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      -QKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNG
A0A2K5NZS5_BCL2-01      -QRGYEW--------DAGDVGAATPGVAPAPGIFSSQPG-HTPHPAASRD
A0A2K5KHH8_BCL2A1-      -I----------------PQPGSGPSK-----------------------
A0A2K5KHH8_BCL2A1-      -I----------------PQPGSGPSK-----------------------
A0A2K5LXU8_MCL1-03      -LNLY----------CGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSG
A0A2K5MMZ4_BCL2L10      ---------------CCAREPGTPEPRPSTP-------------------
A0A2K5MZX9_BCL2L2-      -QKGY----------VCGAGPG--EGPAADP-------------------
                                                                          

A0A2K5LXU8_MCL1-01      ATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAV
A0A2K5MZX9_BCL2L2-      ---------------------EGPAADPL---------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      ATGHSSSLDAREVIPMAA----------V---------------------
A0A2K5NZS5_BCL2-01      PVARTSPLPTPAAPAAAAGPALSPVPPVV---------------------
A0A2K5KHH8_BCL2A1-      ----------------------------T---------------------
A0A2K5KHH8_BCL2A1-      ----------------------------T---------------------
A0A2K5LXU8_MCL1-03      ATSRK-----------------------A---------------------
A0A2K5MMZ4_BCL2L10      ----------------------------E---------------------
A0A2K5MZX9_BCL2L2-      ----------------------------L---------------------
                                                                          

A0A2K5LXU8_MCL1-01      LPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQA
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5LXU8_MCL1-01      TGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-
A0A2K5MZX9_BCL2L2-      -------------------HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-
A0A2K5M8B1_BCL2L1-      ---------------------MWKRTGLRPQKGLNRRWRPPVPSMATHP-
A0A2K5M8B1_BCL2L1-      -------------------KQALREAGDEFELRYRRAFSDLTSQLHITP-
A0A2K5NZS5_BCL2-01      -------------------HLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-
A0A2K5KHH8_BCL2A1-      -------------------SRVLQKVAFSVQKEVEKNLKPCLDNVNVASI
A0A2K5KHH8_BCL2A1-      -------------------SRVLQKVAFSVQKEVEKNLKPCLDNVNVASI
A0A2K5LXU8_MCL1-03      -------------------LETLRRVGDGVQRNHETAFQGMLRKLDIKN-
A0A2K5MMZ4_BCL2L10      -------------------AAVLRSAA----ARLRQLHRSFFSAYRGYR-
A0A2K5MZX9_BCL2L2-      -------------------HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-
                                               . ..                       

A0A2K5LXU8_MCL1-01      EDDVKSLSRVMVHVFSDG-VTNWGRIVTLISFGAFVAK------------
A0A2K5MZX9_BCL2L2-      GSAQQRFTQVSDELFQGG--PNWGRLVAFFVFGAALCA------------
A0A2K5M8B1_BCL2L1-      GTAYQSFEQVVNELFRDG--VNWGRIVAFFSFGGALCV------------
A0A2K5M8B1_BCL2L1-      GTAYQSFEQVVNELFRDG--VNWGRIVAFFSFGGALCV------------
A0A2K5NZS5_BCL2-01      FTARGRFATVVEELFRDG--VNWGRIVAFFEFGGVMCV------------
A0A2K5KHH8_BCL2A1-      DTARTLFNQVMEKEFEDG-IINWGRIVTIFAFEGILIK-----------K
A0A2K5KHH8_BCL2A1-      DTARTLFNQVMEKEFEDG-IINWGRIVTIFAFEGILIK-----------K
A0A2K5LXU8_MCL1-03      EDDVKSLSRVMVHVFSDG-VTNWGRIVTLISFGAFVAK------------
A0A2K5MMZ4_BCL2L10      GNRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKR
A0A2K5MZX9_BCL2L2-      GSAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALCA------------
                              .  :    : .    .***:*::. * . :              

A0A2K5LXU8_MCL1-01      --HLKTINQESCIEPLAESITDVLVRTKRD----WLVKQRGWD-------
A0A2K5MZX9_BCL2L2-      --ESVNKEMEPLVGQVQEWMVAYLETRLAD----WIHSSGGWELEAIKAR
A0A2K5M8B1_BCL2L1-      --ESVDKEMQVLVSRIAAWMATYLNDHLEP----WIQENGGWD-------
A0A2K5M8B1_BCL2L1-      --ESVDKEMQVLVSRIAAWMATYLNDHLEP----WIQENGGWD-------
A0A2K5NZS5_BCL2-01      --ESVNREMSPLVDNIALWMTEYLNRHLHT----WIQDNGGWD-------
A0A2K5KHH8_BCL2A1-      LLRQRIAPDVDTYKEISYFVAEFIMNNTGE----WIRQNGGWE-------
A0A2K5KHH8_BCL2A1-      LLRQRIAPDVDTYKEISYFVAEFIMNNTGE----WIRQNGGWE-------
A0A2K5LXU8_MCL1-03      --HLKTINQESCIEPLAESITDVLVRTKRD----WLVKQRGWD-------
A0A2K5MMZ4_BCL2L10      GFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWD-------
A0A2K5MZX9_BCL2L2-      --ESVNKEMEPLVGQVQEWMVAYLETRLAD----WIHSSGGWA-------
                                           :.  :          *:  . **        

A0A2K5LXU8_MCL1-01      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      VREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIY
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5LXU8_MCL1-01      -GFVEF-FHVEDLE------GGI------RNVLLAVAGVAGVGAGLAYL-
A0A2K5MZX9_BCL2L2-      VGNVDYGATAEELEAHFHGCGSV------NRVTILCDKFSGHPKGFAYIE
A0A2K5M8B1_BCL2L1-      -TFVEL-YGNNAAAESRKGQERF------NRWFLTGMTVAGVVLLGSLFS
A0A2K5M8B1_BCL2L1-      -TFVEL-YGNNAAAESRKGQERFN------RWFLTGMTVAGVVLLGSLFS
A0A2K5NZS5_BCL2-01      -AFVEL-YGPSM-------RPLFDFSWLSLKTLLSLALVGACITLGAYLG
A0A2K5KHH8_BCL2A1-      NGFVKK-LEP-------------------KSGWMTFLEVTGKICEMLSLL
A0A2K5KHH8_BCL2A1-      NGFVKK-FEP-------------------KSGWMTFLEVTGKICEMLSLL
A0A2K5LXU8_MCL1-03      -GFVEF-FHVEDLEGGI------------RNVLLAVAGVAGVGAGLAYLI
A0A2K5MMZ4_BCL2L10      -GFCHF-FRS---------PFPLAFW---RTLLIQAFLACLLATAFGYLW
A0A2K5MZX9_BCL2L2-      -EFTAL-YGDGALEEAR--RLREGNWASVRTVLTGAVALGALVTVGAFFA
                                                                        : 

A0A2K5LXU8_MCL1-01      ------IR------------------------------------------
A0A2K5MZX9_BCL2L2-      FSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRAR
A0A2K5M8B1_BCL2L1-      RK------------------------------------------------
A0A2K5M8B1_BCL2L1-      RK------------------------------------------------
A0A2K5NZS5_BCL2-01      HK------------------------------------------------
A0A2K5KHH8_BCL2A1-      KQYC----------------------------------------------
A0A2K5KHH8_BCL2A1-      KQYC----------------------------------------------
A0A2K5LXU8_MCL1-03      R-------------------------------------------------
A0A2K5MMZ4_BCL2L10      TRLL----------------------------------------------
A0A2K5MZX9_BCL2L2-      SK------------------------------------------------
                                                                          

A0A2K5LXU8_MCL1-01      -------------------------------------
A0A2K5MZX9_BCL2L2-      TTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K5M8B1_BCL2L1-      -------------------------------------
A0A2K5M8B1_BCL2L1-      -------------------------------------
A0A2K5NZS5_BCL2-01      -------------------------------------
A0A2K5KHH8_BCL2A1-      -------------------------------------
A0A2K5KHH8_BCL2A1-      -------------------------------------
A0A2K5LXU8_MCL1-03      -------------------------------------
A0A2K5MMZ4_BCL2L10      -------------------------------------
A0A2K5MZX9_BCL2L2-      -------------------------------------
                                                             

© 1998-2020Legal notice