Dataset for protein BCL-2-like of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5NZS5_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGVAPAPGIFS
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEG---T
A0A2K5KHH8_BCL2A1-      ------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSK------------
A0A2K5KHH8_BCL2A1-      ------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSK------------
A0A2K5KHH8_BCL2A1-      ------MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSK------------
A0A2K5LXU8_MCL1-01      -------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLA
A0A2K5LXU8_MCL1-02      -------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLA
A0A2K5MZX9_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMR
A0A2K5MZX9_BCL2L2-      -MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNG
A0A2K5MZX9_BCL2L2-      -MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNG
A0A2K5LXU8_MCL1-03      -------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLA
A0A2K5MMZ4_BCL2L10      -MADPLRERTER-LLADYLG--------CCAREPGTPEPRPSTP------
A0A2K5MZX9_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG--EGPAADP------
                                                                          

A0A2K5NZS5_BCL2-01      SQPGHTPHPA----------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      ESEMETPSAI----------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-01      TEKEASARRE-----------------IGGGEAGTVIGGSAGASPPAALT
A0A2K5LXU8_MCL1-02      TEKEASARRE-----------------IGGGEAGTVIGGSAGASPPAALT
A0A2K5MZX9_BCL2L2-      AAGDEFETRF----------------RRTFSDLAAQLHVTPGSAQQRFTQ
A0A2K5MZX9_BCL2L2-      LESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEE
A0A2K5MZX9_BCL2L2-      LESEELEPED------------------------------------QEEE
A0A2K5LXU8_MCL1-03      TGAKDTKPMG----------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-01      PDARRVARPPPIGA------------------------------------
A0A2K5LXU8_MCL1-02      PDARRVARPPPIGA------------------------------------
A0A2K5MZX9_BCL2L2-      VSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLE
A0A2K5MZX9_BCL2L2-      EEPGLVEGDPGDGAI-----------------------------------
A0A2K5MZX9_BCL2L2-      EEPGLVEGDPGDGAI-----------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-01      ----------EVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEE
A0A2K5LXU8_MCL1-02      ----------EVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEE
A0A2K5MZX9_BCL2L2-      TRLADWIHSSGGWELEAIKARVREM----------EEEAEKLKELQNEVE
A0A2K5MZX9_BCL2L2-      ----------EDPELEAIKARVREM----------EEEAEKLKELQNEVE
A0A2K5MZX9_BCL2L2-      ----------EDPELEAIKARVREM----------EEEAEKLKELQNEVE
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-01      ELDGYEPEPLGKRPAVLPLLE---------LVGESGNSPSTD--------
A0A2K5LXU8_MCL1-02      ELDGYEPEPLGKRPAVLPLLE---------LVGESGNSPSTD--------
A0A2K5MZX9_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHG
A0A2K5MZX9_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHG
A0A2K5MZX9_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHG
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5NZS5_BCL2-01      -------------------------------ASRDPVARTSPLPTPAAPA
A0A2K5M8B1_BCL2L1-      -----------------------------------MWKRTGLRPQKG---
A0A2K5M8B1_BCL2L1-      -------------------------------NGNPSWHLVDSPAVNGATG
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-01      --------------GSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGA
A0A2K5LXU8_MCL1-02      --------------GSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGA
A0A2K5MZX9_BCL2L2-      CGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKV
A0A2K5MZX9_BCL2L2-      CGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKV
A0A2K5MZX9_BCL2L2-      CGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKV
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5NZS5_BCL2-01      AAAGPALSPVPPV--VHLTLRQAGDDFSRRYRRD--FAEMSSQLHLTPFT
A0A2K5M8B1_BCL2L1-      --------------------------LNRRWRPP--VPSMATH----PGT
A0A2K5M8B1_BCL2L1-      HSSSLDAREVIPMAAVKQALREAGDEFELRYRRA--FSDLTSQLHITPGT
A0A2K5KHH8_BCL2A1-      ---------------TSRVLQKVAFSVQKEVEKN--LKPCLDNVNVASID
A0A2K5KHH8_BCL2A1-      ---------------TSRVLQKVAFSVQKEVEKN--LKPCLDNVNVASID
A0A2K5KHH8_BCL2A1-      ---------------TSRVLQKVAFSVQKEVEKN--LKPCLDNVNVASID
A0A2K5LXU8_MCL1-01      KDTKPMGRSGATSRKALETLRRVGDGVQRNHETA--FQGMLRKLDIKNED
A0A2K5LXU8_MCL1-02      KDTKPMGRSGATSRKALETLRRVGDGVQRNHETA--FQGWVCGV------
A0A2K5MZX9_BCL2L2-      IPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRP------
A0A2K5MZX9_BCL2L2-      IPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRP------
A0A2K5MZX9_BCL2L2-      IPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRP------
A0A2K5LXU8_MCL1-03      -------RSGATSRKALETLRRVGDGVQRNHETA--FQGMLRKLDIKNED
A0A2K5MMZ4_BCL2L10      ---------------EAAVLRSAA----ARLRQL--HRSFFSAYRGYRGN
A0A2K5MZX9_BCL2L2-      ---------------LHQAMRAAGDEFETRFRRT--FSDLAAQLHVTPGS
                                                                          

A0A2K5NZS5_BCL2-01      ARGRFATVVEELFRDG--VNWGRIVAFFEFGGVMCV--------------
A0A2K5M8B1_BCL2L1-      AYQSFEQVVNELFRDG--VNWGRIVAFFSFGGALCV--------------
A0A2K5M8B1_BCL2L1-      AYQSFEQVVNELFRDG--VNWGRIVAFFSFGGALCV--------------
A0A2K5KHH8_BCL2A1-      TARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIK-----------KLL
A0A2K5KHH8_BCL2A1-      TARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIK-----------KLL
A0A2K5KHH8_BCL2A1-      TARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIK-----------KLL
A0A2K5LXU8_MCL1-01      DVKSLSRVMVHVFSDG-VTNWGRIVTLISFGAFVAK--------------
A0A2K5LXU8_MCL1-02      -----------LPCRG-PRRW-----------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5LXU8_MCL1-03      DVKSLSRVMVHVFSDG-VTNWGRIVTLISFGAFVAK--------------
A0A2K5MMZ4_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRGF
A0A2K5MZX9_BCL2L2-      AQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALCA--------------
                                                                          

A0A2K5NZS5_BCL2-01      ESVNREMSPLVDNIALWMTEYLNRHLHT----WIQDNGGWDAFVELYGPS
A0A2K5M8B1_BCL2L1-      ESVDKEMQVLVSRIAAWMATYLNDHLEP----WIQENGGWDTFVELYGNN
A0A2K5M8B1_BCL2L1-      ESVDKEMQVLVSRIAAWMATYLNDHLEP----WIQENGGWDTFVELYGNN
A0A2K5KHH8_BCL2A1-      RQRIAPDVDTYKEISYFVAEFIMNNTGE----WIRQNGGWGK--------
A0A2K5KHH8_BCL2A1-      RQRIAPDVDTYKEISYFVAEFIMNNTGE----WIRQNGGWENGFVKKFEP
A0A2K5KHH8_BCL2A1-      RQRIAPDVDTYKEISYFVAEFIMNNTGE----WIRQNGGWENGFVKKLEP
A0A2K5LXU8_MCL1-01      HLKTINQESCIEPLAESITDVLVRTKRD----WLVKQRGWDGFVEFFHVE
A0A2K5LXU8_MCL1-02      ------HQKCAAGCCRCCWS------RS----WF----------------
A0A2K5MZX9_BCL2L2-      ------RGRVYRGRARA---------TS----WYSPY-------------
A0A2K5MZX9_BCL2L2-      ------RGRVYRGRARA---------TS----WYSPY-------------
A0A2K5MZX9_BCL2L2-      ------RGRVYRGRARA---------TS----WYSPY-------------
A0A2K5LXU8_MCL1-03      HLKTINQESCIEPLAESITDVLVRTKRD----WLVKQRGWDGFVEFFHVE
A0A2K5MMZ4_BCL2L10      QPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWDGFCHFFRS-
A0A2K5MZX9_BCL2L2-      ESVNKEMEPLVGQVQEWMVAYLETRLAD----WIHSSGGWAEFTALYGDG
                                                        *                 

A0A2K5NZS5_BCL2-01      M-------RPLFDFSWLSLKTLLSLALVGACITLGAYLGHK----
A0A2K5M8B1_BCL2L1-      AAAESRKGQERFN------RWFLTGMTVAGVVLLGSLFSRK----
A0A2K5M8B1_BCL2L1-      AAAESRKGQERFN------RWFLTGMTVAGVVLLGSLFSRK----
A0A2K5KHH8_BCL2A1-      ---------------------WHNHMPM---LVESVAHRKKKMAL
A0A2K5KHH8_BCL2A1-      ----------------K--SGWMTFLEVTGKICEMLSLLKQYC--
A0A2K5KHH8_BCL2A1-      ----------------K--SGWMTFLEVTGKICEMLSLLKQYC--
A0A2K5LXU8_MCL1-01      DLEGGI----------R--NVLLAVAGVAGVGAGLAYLIR-----
A0A2K5LXU8_MCL1-02      -----------------------------GISNKIALL-------
A0A2K5MZX9_BCL2L2-      ---------------------------------------------
A0A2K5MZX9_BCL2L2-      ---------------------------------------------
A0A2K5MZX9_BCL2L2-      ---------------------------------------------
A0A2K5LXU8_MCL1-03      DLEGGI----------R--NVLLAVAGVAGVGAGLAYLIR-----
A0A2K5MMZ4_BCL2L10      ------PFPLAFW---R--TLLIQAFLACLLATAFGYLWTRLL--
A0A2K5MZX9_BCL2L2-      ALEEARRLREGNWASVR--TVLTGAVALGALVTVGAFFASK----
                                                                     

© 1998-2022Legal notice