Dataset for protein BCL-2-like of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5NZS5_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGVAPAPGIFS
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEG---T
A0A2K5KHH8_BCL2A1-      -MTDCEFGYIYR-LAQDYLQYVLQIPQPGSGPSKTS--------------
A0A2K5KHH8_BCL2A1-      -MTDCEFGYIYR-LAQDYLQYVLQIPQPGSGPSKTS--------------
A0A2K5LXU8_MCL1-01      ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKE
A0A2K5LXU8_MCL1-03      ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL-----
A0A2K5MZX9_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG--EGPAADPL-----
A0A2K5MMZ4_BCL2L10      -MADPLRERTER-LLADYLG--------CCAREPGTPEPRPSTPE-----
A0A2K5MZX9_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG--EGPAADPL-----
                                                                          

A0A2K5NZS5_BCL2-01      SQPGHTPHPAASRDPVARTSPLPTP-------------------------
A0A2K5M8B1_BCL2L1-      --------------MWKRTGLRPQK-------------------------
A0A2K5M8B1_BCL2L1-      ESEMETPSAINGNPSWHLVDSPAVN-------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-01      ASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTA
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-01      TPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5NZS5_BCL2-01      ------------------------------------------------AA
A0A2K5M8B1_BCL2L1-      ------------------------------------------------G-
A0A2K5M8B1_BCL2L1-      ------------------------------------------------GA
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-01      PLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
A0A2K5LXU8_MCL1-03      ------------------------------------------------AT
A0A2K5MZX9_BCL2L2-      ------------------------------------------------H-
A0A2K5MMZ4_BCL2L10      ------------------------------------------------A-
A0A2K5MZX9_BCL2L2-      ------------------------------------------------H-
                                                                          

A0A2K5NZS5_BCL2-01      PAAAAGPALSPVPPV--VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFT
A0A2K5M8B1_BCL2L1-      ----------------------------LNRRWRPPVPSMATH----PGT
A0A2K5M8B1_BCL2L1-      TGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGT
A0A2K5KHH8_BCL2A1-      -------------------RVLQKVAFSVQKEVEKNLKPCLDNVNVASID
A0A2K5KHH8_BCL2A1-      -------------------RVLQKVAFSVQKEVEKNLKPCLDNVNVASID
A0A2K5LXU8_MCL1-01      GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
A0A2K5LXU8_MCL1-03      GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
A0A2K5MZX9_BCL2L2-      -------------------QAMRAAGDEFETRFRRTFSDLAAQLHVTPGS
A0A2K5MMZ4_BCL2L10      -------------------AVLRSAA----ARLRQLHRSFFSAYRGYRGN
A0A2K5MZX9_BCL2L2-      -------------------QAMRAAGDEFETRFRRTFSDLAAQLHVTPGS
                                                                          

A0A2K5NZS5_BCL2-01      ARGR-FATVVEELFRD--GVNWGRIVAFFEFGGVMCV-------------
A0A2K5M8B1_BCL2L1-      AYQS-FEQVVNELFRD--GVNWGRIVAFFSFGGALCV-------------
A0A2K5M8B1_BCL2L1-      AYQS-FEQVVNELFRD--GVNWGRIVAFFSFGGALCV-------------
A0A2K5KHH8_BCL2A1-      TARTLFNQVMEKEFEDG-IINWGRIVTIFAFEGILIK-------------
A0A2K5KHH8_BCL2A1-      TARTLFNQVMEKEFEDG-IINWGRIVTIFAFEGILIK-------------
A0A2K5LXU8_MCL1-01      DVKS-LSRVMVHVFSDG-VTNWGRIVTLISFGAFVAK-------------
A0A2K5LXU8_MCL1-03      DVKS-LSRVMVHVFSDG-VTNWGRIVTLISFGAFVAK-------------
A0A2K5MZX9_BCL2L2-      AQQR-FTQVSDELFQG--GPNWGRLVAFFVFGAALCA-------------
A0A2K5MMZ4_BCL2L10      RVEL-VALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRG
A0A2K5MZX9_BCL2L2-      AQQR-FTQVSDELFQG--GPNWGRLVAFFVFGAALCA-------------
                             .  :    : .    .***:*::. * . :               

A0A2K5NZS5_BCL2-01      -ESVNREMSPLVDNIAL---WMTEYLNRHLHT----WIQDNGGWD-----
A0A2K5M8B1_BCL2L1-      -ESVDKEMQVLVSRIAA---WMATYLNDHLEP----WIQENGGWD-----
A0A2K5M8B1_BCL2L1-      -ESVDKEMQVLVSRIAA---WMATYLNDHLEP----WIQENGGWD-----
A0A2K5KHH8_BCL2A1-      -KLLRQRIAPDVDTYKEISYFVAEFIMNNTGE----WIRQNGGWEN----
A0A2K5KHH8_BCL2A1-      -KLLRQRIAPDVDTYKEISYFVAEFIMNNTGE----WIRQNGGWEN----
A0A2K5LXU8_MCL1-01      -HLKTINQESCIEPLAE---SITDVLVRTKRD----WLVKQRGWD-----
A0A2K5LXU8_MCL1-03      -HLKTINQESCIEPLAE---SITDVLVRTKRD----WLVKQRGWD-----
A0A2K5MZX9_BCL2L2-      -ESVNKEMEPLVGQVQE---WMVAYLETRLAD----WIHSSGGWELEAIK
A0A2K5MMZ4_BCL2L10      FQPRLKEQEGDVARDCQ---RLVALLSSRLAGQHRAWLQAQGGWD-----
A0A2K5MZX9_BCL2L2-      -ESVNKEMEPLVGQVQE---WMVAYLETRLAD----WIHSSGGWA-----
                                   :         :.  :          *:  . **      

A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5KHH8_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-01      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARS
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5NZS5_BCL2-01      ------------------------------------------AFVELYGP
A0A2K5M8B1_BCL2L1-      ------------------------------------------TFVELYGN
A0A2K5M8B1_BCL2L1-      ------------------------------------------TFVELYGN
A0A2K5KHH8_BCL2A1-      ------------------------------------------GFVKKLE-
A0A2K5KHH8_BCL2A1-      ------------------------------------------GFVKKFE-
A0A2K5LXU8_MCL1-01      ------------------------------------------GFVEFFHV
A0A2K5LXU8_MCL1-03      ------------------------------------------GFVEFFHV
A0A2K5MZX9_BCL2L2-      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
A0A2K5MMZ4_BCL2L10      ------------------------------------------GFCHFFRS
A0A2K5MZX9_BCL2L2-      ------------------------------------------EFTALYGD
                                                                   :      

A0A2K5NZS5_BCL2-01      SM-------RPLFDFSWLSLKTLLSLALVGACITLGAYLGHK--------
A0A2K5M8B1_BCL2L1-      NAAAESRKGQERFN------RWFLTGMTVAGVVLLGSLFSRK--------
A0A2K5M8B1_BCL2L1-      NAAAESRKGQERFN------RWFLTGMTVAGVVLLGSLFSRK--------
A0A2K5KHH8_BCL2A1-      ------------------PKSGWMTFLEVTGKICEMLSLLKQYC------
A0A2K5KHH8_BCL2A1-      ------------------PKSGWMTFLEVTGKICEMLSLLKQYC------
A0A2K5LXU8_MCL1-01      EDLEGG------------IRNVLLAVAGVAGVGAGLAYLIR---------
A0A2K5LXU8_MCL1-03      EDLEGG------------IRNVLLAVAGVAGVGAGLAYLIR---------
A0A2K5MZX9_BCL2L2-      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNY
A0A2K5MMZ4_BCL2L10      -------PFPLAFW-----RTLLIQAFLACLLATAFGYLWTRLL------
A0A2K5MZX9_BCL2L2-      GALEEARRLREGNWAS--VRTVLTGAVALGALVTVGAFFASK--------
                                                                          

A0A2K5NZS5_BCL2-01      ---------------------------------
A0A2K5M8B1_BCL2L1-      ---------------------------------
A0A2K5M8B1_BCL2L1-      ---------------------------------
A0A2K5KHH8_BCL2A1-      ---------------------------------
A0A2K5KHH8_BCL2A1-      ---------------------------------
A0A2K5LXU8_MCL1-01      ---------------------------------
A0A2K5LXU8_MCL1-03      ---------------------------------
A0A2K5MZX9_BCL2L2-      NSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K5MMZ4_BCL2L10      ---------------------------------
A0A2K5MZX9_BCL2L2-      ---------------------------------
                                                         

© 1998-2020Legal notice