Dataset for protein BCL-2-like of organism Cercocebus atys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------r-lvgdlrsyklrqvlyvpgagsgageg-a--p------------------------------------
mmaapamadde-gyiyrkaqdyiqyrgqcgqp-l-pss-p-tp-ggrllateseeteprelllepepepepeeepprigg
 ahtarstpctfemfalfvnav-gln--ic--f-e--ktgpggaldygnglskmasprei                 rtf
   dglasaanaaaa-gylg--g--khl-wsrepvvp-prtad epqimtsqpkhlatpg                 pra
      tgyta  --v-rg-gp sr-  s-dq gdteanagva ahgafsegggdfksmf                    
      rers   ilmk--h        e a  d ga    st      raaed   had                    
        q         i                      e          a      a                    
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
geagtviggsagasppqeltpeprlvegpppigaivaffvfgaalcaesvnkemeplvgqvqewmvayletrladwihss
splapqphvts spqsaaeeedagrfard gd rl                                             
pdg agl pgp  agqrftqvsde  q g nw                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
evpeleaikarvremaptrraapleeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiyvgnvdygat
gdwdvt tp  llff           m  paadaimspe eldgye e lgkr avlpll          l  esgnsps
 g                                                                              
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------------------------tsrvl
aeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldesllrgrqikvipkrtnrrsisttrrglpta
td                      gsl stpppa eeed lysqpswirtryfpeqatgakdtkpmgpggapsdkafer-
                                         ngrdpekisgsravpgatghsssldlspvp vaavhqam
                                         a n mvhlvdpp tn  p aaag aa e i m  ---- 
                                               a      qk                   lkl  
                                                                           eaa  
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ryvadtvqrnvera--fsgmlsrl-----d----l--vv-elf-dg---nwgrivt-f-fgg-l-k--------------
qragrstnyrsrtsrfyqpfndqvnvtpg-avrs-fq--m---s--giv-------f-s---i-c-replvtawwkkkll
-kr-fgfekehskn  lkscarnphiasittaqtfsnqmvhveredpvit   v alia eaaviv           rgf
 -- ----t y qt  vrdlvtk-dlknesdykrvermsnakpfrs gtr   l sivv a fmae              
 s   elsl w pp  hpewtchyrgyrfnrrgl at ae  lqg  pp         t   v la              
 q   d  a l  l   a  sag        qe  tl  d   c    r         e   t                 
 e        f  d      f a                                                         
 a                                                                              

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                *                                               
-----emerlyrgiarwmae-l---lts----Wiqqnggwd-f----------------------------ll----v-g
esvik-rvdvvkrrsyf---y-nrn-reqhra yspy----g-velygvpaleesrkgrerfwfswrsltv--tvmt-a-
rqrtapqqvtiselceavttfimnhtgd     lrkqr  etgfvffhnndaaggirlqplnna vk  swwmagalmta
hlknindgscaepvqasivdv vdtkep     fve-   gn thkkreem   a pfplg d   l  rgftsflglgl
qp dr hspd aqd qrlwal str at      --s   ak ca  lss          a        nt iqaveac 
   l    k  gnc lcc s  es  hg      hs     e     fpg                   kl hnlfp   
        g  d                       d     a      d                        gh a   
                                   a                                            

       490     
....:....|....:
               
----gayl-------
vvtl----srkycal
lilemslflkqlm  
kgcgllshitrkl  
isavsvf ws     
clvkiga rh     
 anaf   g      
        a      
© 1998-2022Legal notice