Dataset for protein BCL-2-like of organism Cercocebus atys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------m-----gyd-r-lvadylgyklr-----q-gy------------gagpg--ps----
mfglkrnaviglnlycggaglgm-adpat-p-y-e-aq-fvq-v--eiggg-k--swsqfsdveevc-pq--agegkatt
                      agttgesa-it am--lk--s-rs     irlte         crt--lest--vpsp
                       asgcrfsrtn lilvk-rsaaiq     ln            niarvgatssprmpd
                        ha lrpqsg   fte in   g     ea            dg gsa gp  p la
                            me ge    m  eh                        a ee      g e 
                                     g   a                          da      e a 
                                                                            a   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
p-----------------------------------------------v-------------------------------
-garsvapgwhtvkpvavvgatsrtsslpaptvraaaagpmespaadvtmspeeeldgyepeplgkrpavlpllelvges
 siirsqtspplthsppsstpvphslpfftrerppmpleealg vpppl                               
 dgfnlnrpakipdemgrrd  gar l d  aai        a    a-                               
    lg     dga a dn   a k                       i                               
                                                e                               
                                                a                               
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                               . ..             
-----------------------------------------------------------hqvlrragdevqrryrrafsp
gnspstdgslpstpppaeeeedelyrqsleiisrylreqatgakdtkpmgrsgatsrkasrtmqkvafsfeknvettlrd
                                                           leawka-g--telnknwqg
                                                           --m  s  l-pslgh qrhks
                                                           kl   q   r  a f  l ae
                                                           aa   e   d       d   
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                .  :    : .    .***:*::. * . :                                 :
mlsqlhvtp-gtavqsftqVmeelFsdg--vNWGRiVaffsFggalck--------------esvnkemeplvsriaewm
larnvniksiesdrtrlsrmvvkvlrg-pvpt   l tliv eaivivreplvtawwkkkllrqrtipqvvtykqvsysv
cvdkydtan ddryklvnt snhe q s it    v siva a fmaa           rgfhlkiandqscigplqafi
ptasmrlyr fn qg  el ada  e   gi         t   v le              qp dr  sdd eedcqrl
fspa agh      e                       e   t                    l    g  dn  l  
 f                                                                       a      
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.  :          *:  . **                                                          
aeylnrrlad----WiqsngGWd---------------------------------------------------------
vavivthtrpqhra lvqqr  eleaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiy
ttf mntkge      rks   a                                                         
 dl edn et      he                                                              
    ss  hg       d                                                              
                 a                                                              
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                :                               
-gFvel-ygp-------------------rrvlltvatvagvvtlgaylsrk----------------------------
ntntkfgfhvealeesrkgrgrfnfwwsvntwwmagmlltalilgmssflk-ycesvrtslaldeslfrgrqikvipkrt
ve chk lenndaaghih qesvgnsalsksgfisflgfglkgcellli--qll  i                       
 a  dy atssm  agf  pppld     -ntttqaveas hpavfgf wtsdk                          
    a   rdge   a   cllia     lkl  llfk c caka    isr                            
         a          fge           gcda           gh                             
                                                 ef                             
                                                 a                              

       490       500       510       520       530       
....:....|....:....|....:....|....:....|....:....|....:..
                                                         
---------------------------------------------------------
nrpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrgraratswyspy
                                                         
                                                         
                                                         
                                                         
                                                         
                                                         
© 1998-2020Legal notice