Dataset for protein BCL-2-like of organism Cercocebus atys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-m-------dyr-lvadylgykl-qkgygcgagsg--e-p---pl-----------------------------------
m-adpesgymtglkrqafiq---y----vw-psptga-p-ggr--ptiktssprrtpspinsrtvwkrtssrpvpaaltp
 attcafapin-e-an-vv-lv sipqp-ss--k-sptgraadleggefseqemheihggegnpsvhlvgppstn     
  hagrtsr-f ai--k--s n rcg asldrf-vveat tva aa   ea age  gaaaagdpiggsdllaqk     
     lreqt-   lv   h   q r  e-aqeddt  n pst                     m a  aga p      
      m  se    m            c            e                                      
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
darrvarpppigaevpdvtatparllffaptrraapleemeapaadaimspeeeldgyepeplgkrpavlpllelvgesg
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------a--------------------qvlrragdevqrryrrafsdm
nspstdgslpstpppaeeeedelyrqsleiisrylreq-tgakdtkpmgrsvatsrkvlrtmqkva--fetnvettlqsl
                                      hatghsssldlspgppvaaakea--a--fs--keh knvkpc
                                      g p aaag aa e i m   h--  -   glsl f qphrgf
                                                           l   s   d na w pl pe 
                                                           a   q        l  d a  
                                                               e                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               .  :    : .    .***:*::. * . :                          :        
lsqlhvtpgdavqs-ftqVmeelFsd--gvNWGRiVaffsFggalck--------------esvnkemeplvdriae---
arnvniksittyrrllsrmvvkvlrggpvpt   l tliv eaivivreplvtawwkkrgfklltqrqqvdistyqaisy
tdk-d-anesdqkt vnt snhe q s it    v siva a fmaa              hpkriniasc gqvkq   
sahy-l-rfnragl  el ada  e    i         t   v le              q rdr  sg  eplcl   
fta rgy    re                        e   t                    l       and     
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :.  :          *:  . **                                                        
wmaeylnrrlad----WiqsngGWd-------------------------------------------------------
svvavivthtrpqhra lvqqr  eneaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadars
fittf mntkge      rks   al                                                      
rl dl edn et      he                                                            
      ss  hg       d                                                            
                   a                                                            
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                           :                                    
------------------------------------------gFvelyg--------------------rtvlltvatva
iyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgftytkffhvealeesrklrerfwrswqikswwmagmlpg
                                          a ihksenndaagglrgqpsnnfgrlp-rgftsflglt
                                          e ca lrsssvrta pfplllfa   vlntpkraveac
                                                dpgm     a d g d    s vl iqtnr  
                                                 k           a        ki  glfa  
                                                 d                              

       490       500       510       520       530   
....:....|....:....|....:....|....:....|....:....|...
                                                     
gvvtlgaylsrk-----------------------------------------
alilgmssflk-ycarttnynssrsrfysgfnsrprgrvyrgraratswyspy
lkgcelllpitrlr                                       
istavrgf wsq l                                       
 ca df   rh                                          
    a    ga                                          
         a                                           
© 1998-2020Legal notice