Dataset for protein Bcl-w of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q45T69_BCL2L2-04      MAGSLAVRCGARFTC-----------------------------------
Q45T69_BCL2L2-05      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
Q45T69_BCL2L2-01      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q45T69_BCL2L2-02      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
Q45T69_BCL2L2-03      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                      ** . :.      .                                    

Q45T69_BCL2L2-04      HETDVSPSNLTSQSASERAI-----------------------AARRSED
Q45T69_BCL2L2-05      ESEELEPEELLLEPEPEPELEEDPPRAPRLPGSSGPWPGSGAPGSQEEEE
Q45T69_BCL2L2-01      DEFETRFRRTFSDLAAQLHV------------------TPGSAQQRFTQV
Q45T69_BCL2L2-02      DEFETRFRRTFSDLAAQLHV------------------TPGSAQQRFTQV
Q45T69_BCL2L2-03      DEFETRFRRTFSDLAAQLHV------------------TPGSAQQRFTQV
                       . :        :  .:  :                         .  : 

Q45T69_BCL2L2-04      WPCLLALASGQSPSVIYSRIRLE---------------------------
Q45T69_BCL2L2-05      EPGLVEGDPGDGA------IEDP---------------------------
Q45T69_BCL2L2-01      SDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLET
Q45T69_BCL2L2-02      SDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLET
Q45T69_BCL2L2-03      SDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLET
                         *.   .. .       :                              

Q45T69_BCL2L2-04      ------------ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
Q45T69_BCL2L2-05      ------------ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
Q45T69_BCL2L2-01      RLADWIHSSGGWA-EFTALYGDGALEEARRLRE---------------GN
Q45T69_BCL2L2-02      RLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
Q45T69_BCL2L2-03      RLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
                                    *          *** .*.*               **

Q45T69_BCL2L2-04      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
Q45T69_BCL2L2-05      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
Q45T69_BCL2L2-01      WASV------------RTVLTGAVALGALVT-------------------
Q45T69_BCL2L2-02      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
Q45T69_BCL2L2-03      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
                       ..*            *:: .* *  ** .                    

Q45T69_BCL2L2-04      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
Q45T69_BCL2L2-05      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
Q45T69_BCL2L2-01      --------------------------------------------------
Q45T69_BCL2L2-02      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
Q45T69_BCL2L2-03      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
                                                                        

Q45T69_BCL2L2-04      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSP
Q45T69_BCL2L2-05      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSP
Q45T69_BCL2L2-01      -------------------------------------------VGAFFAS
Q45T69_BCL2L2-02      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWFL-
Q45T69_BCL2L2-03      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSP
                                                                 . :::  

Q45T69_BCL2L2-04      Y
Q45T69_BCL2L2-05      Y
Q45T69_BCL2L2-01      K
Q45T69_BCL2L2-02      -
Q45T69_BCL2L2-03      Y
                       

© 1998-2020Legal notice