Dataset for protein Bcl-w of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:.*:*. : . ...  .   *..  * ***  .***.....   .    .:*:*.      .:*  :    * . :: 
MAtpAsApdtralvadfvgyklRqkgyVcGAG--pGEGpaadplhqamraagdEfEtrfrrtfsdLaaqlhvtPgsaqqr
  aa a aaaagaaggrgsgpg rrhl p   gea   apggagdygnglese l p------ee llepepe epeeep
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    :     * **. *            .. * ::* ** : : :    *  :. *            *          
ftqvsdelfqG-GPnwGrlvaffvfgaalcaeSvnkEmEPlvgqvqewmvAyletrLadwihssggw--Eaikarvreme
prprappgap p  gs ------------apg qee e  glvegdpgdg iedpe ----------el ftalygdgal
                                                                   a            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*** .*.*               ** ..*            *:: .* *  ** .                         
EEAekLkElqnevekqmnmspppGNagpVimsieekmeadaRsiyvGnVdyGAtaeeleahfhgcgsvnrvtilcdkfsg
   rr r ---------------  was ------------ tvlt a al  lvt------------------------
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
hpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrprg
--------------------------------------------------------------------------------
                                                                                

       330      
....:....|....:.
        . ::::. 
rvyrgraratswyspy
--------vgaffask
                
© 1998-2022Legal notice