Dataset for protein Bcl-w of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
** . :.      .                                     . :        :  .:  :          
MAtpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrfrrtfsdlaaqlhv----------
  gslavrcgarftg-----------------------------------hstdvspsnltlqsesereleedppraprl
  aa   aaa gaacgrgsgpg rrhl p   gea eg pggagdygngle e le ee l ep pai          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               .  :    *.   .. .       :                                        
--------tpgsaqqrftqvsdeLfqggpnwgrlvaffvfgaalcaesvnkemeplvgqvqewmvayletrladwihssg
pgssgpwp-----gsqrseewpg veldsgqsp------irlp-------------------------------------
        gs apaa ee de c la a  d as iysr ede                                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    *          *** .*.*               ** ..*            *:: .* *  ** .          
gwelEaikarvremeEEAekLkElqnevekqmnmspppGNagpVimsieekmeadaRsiyvGnVdyGAtaeeleahfhgc
--a- ftalygdgal   rr r ---------------  was ------------ tvlt a al  lvt---------
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
gsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnyns
--------------------------------------------------------------------------------
                                                                                

       330       340       350 
....:....|....:....|....:....|.
                       . :::   
srsrfysgfnsrprgrvyrgraratswyspy
-----------------------vgaffl--
                            ask
© 1998-2020Legal notice