Dataset for protein Bcl-xL of organism Buteo japonicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0AYR5_BCL2L1-      MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAAEEAEMDGVLNG
A0A8C0AYR5_BCL2L1-      MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAAEEAEMDGVLNG
                        **************************************************

A0A8C0AYR5_BCL2L1-      SPSWHPPASHVVNGAAMHRSSLEVHEIVQTADVRQALREAGDEFELRYRR
A0A8C0AYR5_BCL2L1-      SPSWHPPASHVVNGAAMHRSSLEVHEIVQTADVRQALREAGDEFELRYRR
                        **************************************************

A0A8C0AYR5_BCL2L1-      AFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVE
A0A8C0AYR5_BCL2L1-      AFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVE
                        **************************************************

A0A8C0AYR5_BCL2L1-      SVDKEMRVLVGRVVSWMTTYLTDHLDPWIQENGGWSRPWPLSPALSHTSL
A0A8C0AYR5_BCL2L1-      SVDKEMRVLVGRVVSWMTTYLTDHLDPWIQENGGWER---------FVDL
                        ***********************************.*         ...*

A0A8C0AYR5_BCL2L1-      RGRGAVAVCRAVALLKFARLLLLLEMKDWRQPAWTSRAGVT---AFLARP
A0A8C0AYR5_BCL2L1-      YGNDAAAEVRK-GQETFNKWLL----------TGATVAGVLLLGSLLSRK
                         *..*.*  *  .  .* . **          : :: ***    ::*:* 

A0A8C0AYR5_BCL2L1-      RAWPALPKPRERPEFHDPECLPSP
A0A8C0AYR5_BCL2L1-      ------------------------
                                                

© 1998-2023Legal notice