Dataset for protein Bcl-xL of organism Buteo japonicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAAEEAEMDGVLNGSPSWHPPASHVVNGAAMHRSSLEVHEIVQT
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLV
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************.*         ...* *..*.*  *  .  .* . **          : :: ***
GRVVSWMTTYLTDHLDPWIQENGGWsR---------hvsLyGrgAvAvvRk-gqltFnrwLL----------twttvAGV
                         e pwplspalsftd r nd a ec avalek akl  llemkdwrqpagasr   

       250       260       270    
....:....|....:....|....:....|....
    ::*:*                         
t---slLsRp------------------------
lllgaf a krawpalpkprerpefhdpeclpsp
© 1998-2022Legal notice