Dataset for protein Bcl-w of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5CWY6_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A2K5CWY6_BCL2L2-      ----------MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGE-GA
A0A2K5CWY6_BCL2L2-      ------------HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5CWY6_BCL2L2-      MPLLVLCPYIHASLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
                                                .  .*.*. *  :.  .* :  : * 

A0A2K5CWY6_BCL2L2-      VCGAG------------------------------------PGEGPAADP
A0A2K5CWY6_BCL2L2-      PGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPGLVEGDPGDGAIEDP
A0A2K5CWY6_BCL2L2-      VCGAG------------------------------------PGEGPAADP
A0A2K5CWY6_BCL2L2-      VCGAG------------------------------------PGEGPAADP
                          ***                                    **:*.  **

A0A2K5CWY6_BCL2L2-      LHQAMRAAGDEFE---TRFRRTFSDLAAQLHVTPG---------SAQQRF
A0A2K5CWY6_BCL2L2-      ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKM
A0A2K5CWY6_BCL2L2-      LHQAMRAAGDEFE---TRFRRTFSDLAAQLHVTPG---------SAQQRF
A0A2K5CWY6_BCL2L2-      LHQAMRAAGDEFE---TRFRRTFSDLAAQLHVTPG---------SAQQRF
                          :*:.*   *:*    .:.   .::  *::::*          * ::.:

A0A2K5CWY6_BCL2L2-      TQVSDELFQGGPNWGRLVAFF--VFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5CWY6_BCL2L2-      EADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGF--
A0A2K5CWY6_BCL2L2-      TQVSDELFQGGPNWGRLVAFF--VFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5CWY6_BCL2L2-      TQVSDELFQGGPNWGRLVAFF--VFGAALCAESVNKEMEPLVGQVQEWMV
                           : .:: *. ::*  .  :   * .. ..: *.   : : *: : :  

A0A2K5CWY6_BCL2L2-      AYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMS
A0A2K5CWY6_BCL2L2-      AYIEFSDKESVRTSLAL---------------------------------
A0A2K5CWY6_BCL2L2-      AYLETRLADWIHSSGGW---------------------------------
A0A2K5CWY6_BCL2L2-      AYLETRLADWIHSSGGW---------------------------------
                        **:*    : :.:* .                                  

A0A2K5CWY6_BCL2L2-      PPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNR
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5CWY6_BCL2L2-      VTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVDFKAFI
A0A2K5CWY6_BCL2L2-      --------------------------------DESLFRGRQIK-------
A0A2K5CWY6_BCL2L2-      --------------------------------AEF---------------
A0A2K5CWY6_BCL2L2-      --------------------------------AEF---------------
                                                         *                

A0A2K5CWY6_BCL2L2-      YSSLTQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSR
A0A2K5CWY6_BCL2L2-      ------VIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSR
A0A2K5CWY6_BCL2L2-      ----------------TALYGDGALEEARRLREGNWASVRTVLTGAV---
A0A2K5CWY6_BCL2L2-      ----------------TALYGDGALEEARRLREGNWASVRTVLTGAV---
                                         :  . *      * *  *: * *: : ...   

A0A2K5CWY6_BCL2L2-      PRGRVYRGRARATSWYSPY
A0A2K5CWY6_BCL2L2-      PRGRVYRGRARATSWYSPY
A0A2K5CWY6_BCL2L2-      ----ALGALVTVGAFFASK
A0A2K5CWY6_BCL2L2-      ----ALGALVTVGAFFASK
                            .  . . . ::::. 

© 1998-2022Legal notice