Dataset for protein Bcl-w of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5CWY6_BCL2L2-      ------------HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5CWY6_BCL2L2-      MPLLVLCPYIHASLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
                                     *************************************

A0A2K5CWY6_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
A0A2K5CWY6_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
                        **************************************************

A0A2K5CWY6_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5CWY6_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
                        **************************************************

A0A2K5CWY6_BCL2L2-      AYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGA
A0A2K5CWY6_BCL2L2-      AYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGA
                        **************************************************

A0A2K5CWY6_BCL2L2-      VALGALVTVGAFFASK
A0A2K5CWY6_BCL2L2-      VALGALVTVGAFFASK
                        ****************

© 1998-2020Legal notice