Dataset for protein Bcl-w of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5CWY6_BCL2L2-      ------------HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5CWY6_BCL2L2-      MPLLVLCPYIHASLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5CWY6_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A2K5CWY6_BCL2L2-      -----------------------MAAAAAAAAAAGAAGGRGSGPGRRRHL
                                               **:.*:*. : . ...  .   *..  

A0A2K5CWY6_BCL2L2-      VCGAG--PGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSA
A0A2K5CWY6_BCL2L2-      VCGAG--PGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSA
A0A2K5CWY6_BCL2L2-      VCGAG--PGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSA
A0A2K5CWY6_BCL2L2-      VPGAGGEAGEGAPGGAGDYGNGLESEELE----------PEELLLEPEPE
                        * ***  .***.....   .    .:*:*          . :* : * . 

A0A2K5CWY6_BCL2L2-      QQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEW
A0A2K5CWY6_BCL2L2-      QQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEW
A0A2K5CWY6_BCL2L2-      QQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEW
A0A2K5CWY6_BCL2L2-      PE--PEEEPGLVEGDPGDGAI-----------------------------
                         :  .: .  *.:*.*. * :                             

A0A2K5CWY6_BCL2L2-      MVAYLETRLADWIHSSGGWA-EFTALYGDGALEEARRLRE----------
A0A2K5CWY6_BCL2L2-      MVAYLETRLADWIHSSGGWA-EFTALYGDGALEEARRLRE----------
A0A2K5CWY6_BCL2L2-      MVAYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMN
A0A2K5CWY6_BCL2L2-      ----------------EDPELEAIKARVREMEEEAEKLKELQNEVEKQMN
                                         .   *          *** .*.*          

A0A2K5CWY6_BCL2L2-      -----GNWASV------------RTVLTGAVALGALVT------------
A0A2K5CWY6_BCL2L2-      -----GNWASV------------RTVLTGAVALGALVT------------
A0A2K5CWY6_BCL2L2-      MSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSV
A0A2K5CWY6_BCL2L2-      MSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSV
                             ** ..*            *:: .* *  ** .             

A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      NRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVDFKA
A0A2K5CWY6_BCL2L2-      NRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIK-----
                                                                          

A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      FIYSSLTQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFN
A0A2K5CWY6_BCL2L2-      --------VIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFN
                                                                          

A0A2K5CWY6_BCL2L2-      -------------VGAFFASK
A0A2K5CWY6_BCL2L2-      -------------VGAFFASK
A0A2K5CWY6_BCL2L2-      SRPRGRVYRGRARATSWYSPY
A0A2K5CWY6_BCL2L2-      SRPRGRVYRGRARATSWYSPY
                                     . ::::. 

© 1998-2022Legal notice