Dataset for protein Bcl-w of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       **:.*:*. : . ...  .   *..  * ***  .***.....   .    .:*:* 
-----------------------MAtpAsApdtralvadfvgyklRqkgyVcGAG--pGEGpaadplhqamraagdEfEt
mpllvlcpyihaslsslpliaar  aa a aaaagaaggrgsgpg rrhl p   gea   apggagdygnglese l -
            h                                                                   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         . :* : * .  :  .: .  *.:*.*. * :                                       
rfrrtfsdlaaqLhvtPgsaqqrftqvsdeLfqGgPnwGrlvaffvfgaalcaesvnkemeplvgqvqewmvayletrla
---------pee lle epepe--peeepg ve d gd ai---------------------------------------
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .   *          *** .*.*               ** ..*            *:: .* *  ** .   
dwihssggwe-EftklyvrgmlEEArrLrE---------------GNwgsV------------RtvyvGnVdyGAtvt--
------edpal aiaargdeae   ek k lqnevekqmnmsppp  aap imsieekmeada silt a al  laeel
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
eahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvdfkafiyssltqvipkrtnrpgis
                                                                                

       330       340       350       360       370 
....:....|....:....|....:....|....:....|....:....|.
                                           . ::::. 
-------------------------------------------vtswyssy
ttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrgraragaffapk
                                                   
© 1998-2022Legal notice