Dataset for protein Bcl-w of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        .  .*.*. *  :.  .* :  : *   ***                         
-------------lsslpliaarmatpaSaPdtRalvadfvGyklrqkGyvcGAG-------------------------
mpllvlcpyimas----------aggrg g gr rhlvpga geage- apg   dygngleseelepeelllepepepe
          h haaaaaaa ga                                                         
            a                                                                   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           **:*.  **  :*:.*   *:*    .:.   .::  *::::*          * ::.:   : .:: *
-----------PGeGpaaDPlhqAmrAagdEfE---trfrrtfsdlaaQlhvtPg---------SaqqrftqvsdelfqG
peeepglvegd  d aie  ele ik rvr m eeaeklkelqnevek mnms ppgnagpvim ieekmeadarsiyv 
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. ::*  .  :   * .. ..: *.   : : *: : :  **:*    : :.:* .                        
gpnwGrlvaff--vFgaalcaesVnkemeplvGqvqewmvAYlEtrladwihsSggw-----------------------
nvdy ataeeleah hgcgsvnr tilcdkfs hpkgf--  i fsdkesvrt laleleaikarvremeeeaeklkelq
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
nevekqmnmspppgnagpvimsieekmeadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayief
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             *                                 :  . *      * *  *: * *: : ...   
------------dEs-------------------------------tstygrGfpreryRlRttNynSvRtvlysgv---
sdkesvrtslala flfrgrqikvdfkafiyssltqvipkrtnrpgialtdd aleaar a eg wa s srftgafnsr
                                                                                
                                                                                

       410         
....:....|....:....
    .  . . . ::::. 
----vyrgrvtvtswyssy
prgralgalaragaffapk
                   
                   
© 1998-2021Legal notice