Dataset for protein BCL-2-like of organism Anabas testudineus

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N6A4C8_BCL2-07      --------------------------------------------------
A0A7N6A4C8_BCL2-01      --------------------------------------------------
A0A3Q1IAB0_BCL2L10      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      --------------------------------------------------
A0A3Q1JZ46_BCL2L1-      --------------------------------------------------
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A7N6A4C8_BCL2-03      MQTALSRGERVQHGTLIRLLHIFDSLPNQRTTPPPTSVFRHPLSGPSPAS
A0A7N6A4C8_BCL2-04      --------------------------------------------------
A0A7N6A4C8_BCL2-06      --------------------------------------------------
A0A7N6A4C8_BCL2-02      --------------------------------------------------
A0A7N6A4C8_BCL2-05      --------------------------------------------------
                                                                          

A0A7N6A4C8_BCL2-07      ------------------------MSSEEGLSSTITDWLFINSWWLLLPF
A0A7N6A4C8_BCL2-01      -----------------------------------------------MAN
A0A3Q1IAB0_BCL2L10      --------------------------------------------------
A0A3Q1GZ93_BCL2L1-      -------------------------------------------------M
A0A3Q1JZ46_BCL2L1-      ---------------------------------------------MEEMS
A0A3Q1GX28_MCL1-02      --------------------------------------------------
A0A3Q1GX28_MCL1-01      --------------------------------------------------
A0A7N6A4C8_BCL2-03      YLGYRTPEAGLLVSRRANDCQISPMSSEEGLSSTITDWLFINSWWLLLPF
A0A7N6A4C8_BCL2-04      --------------------------------------------------
A0A7N6A4C8_BCL2-06      --------------------------------------------------
A0A7N6A4C8_BCL2-02      --------------------------------------------------
A0A7N6A4C8_BCL2-05      --------------------------------------------------
                                                                          

A0A7N6A4C8_BCL2-07      IMLLVIAAFIVAFVLLLYMISPLISPK------------PLKLNGAHVVV
A0A7N6A4C8_BCL2-01      ECNRNIVEKYICHKL-------------------SKRGYAWGFHDAQDE-
A0A3Q1IAB0_BCL2L10      -------MFQLSWGLFLLEAESADKCADAEGKLRVHRGSPSAVRMCREQT
A0A3Q1GZ93_BCL2L1-      SQNRELVVFYITYKL-------------------SQRNYPLNHLGLNETP
A0A3Q1JZ46_BCL2L1-      NSNRELVEFFIMYKL-------------------SQRNHPASLLRPDDT-
A0A3Q1GX28_MCL1-02      ----MLPSGRTAMKLATGGMSCLMLPQNGVVEYSSGVNSPQITMSSSIDA
A0A3Q1GX28_MCL1-01      ----MLPSGRTAMKLATGGMSCLMLPQNGVVEYSSGVNSPQITMSSSIDA
A0A7N6A4C8_BCL2-03      IMLLVIAAFIVAFVLLLYMISPLISPK------------PLKLNGAHVVV
A0A7N6A4C8_BCL2-04      -MLLVIAAFIVAFVLLLYMISPLISPK------------PLKLNGAHVVV
A0A7N6A4C8_BCL2-06      -MLLVIAAFIVAFVLLLYMISPLISPK------------PLKLNGAHVVV
A0A7N6A4C8_BCL2-02      -MLLVIAAFIVAFVLLLYMISPLISPK------------PLKLNGAHVVV
A0A7N6A4C8_BCL2-05      -MLLVIAAFIVAFVLLLYMISPLISPK------------PLKLNGAHVVV
                                      *                        .          

A0A7N6A4C8_BCL2-07      TGGSSGIGKCIAIECYRQGAFITL--------------------VARNEV
A0A7N6A4C8_BCL2-01      ----DAANNGS--------------AVPPPPTLVRRCREASTGPDSDSIP
A0A3Q1IAB0_BCL2L10      DIAGRKMSCGL--------------WKDTLALAEDYLSLCCTSPWPAPP-
A0A3Q1GZ93_BCL2L1-      NRTDGGEDGLS--------------EEQRIATHANGTFNGRSPGTPPASP
A0A3Q1JZ46_BCL2L1-      --------GGV--------------GDRPNSAAANGLPVSRSGELGNSS-
A0A3Q1GX28_MCL1-02      CNGNAALKRPKNLDVSSSNGYATKNIGANSDDIEDGSLPCTPELMSDSE-
A0A3Q1GX28_MCL1-01      CNGNAALKRPKNLDVSSSNGYATKNIGANSDDIEDGSLPCTPELMSDSE-
A0A7N6A4C8_BCL2-03      TGGSSGIGKCIAIECYRQGAFITL-VARNEAKLLQAKKEIEKFAINDKQV
A0A7N6A4C8_BCL2-04      TGGSSGIGKCIAIECYRQGAFITL-VARNEAKLLQAKKEIEKFAINDKQV
A0A7N6A4C8_BCL2-06      TGGSSGIGKCIAIECYRQGAFITL-VARNEAKLLQAKKEIEKFAINDKQV
A0A7N6A4C8_BCL2-02      TGGSSGIGKCIAIECYRQGAFITL-VARNEAKLLQAKKEIEKFAINDKQV
A0A7N6A4C8_BCL2-05      TGGSSGIGKCIAIECYRQGAFITL-VARNEAKLLQAKKEIEKFAINDKQV
                                                                          

A0A7N6A4C8_BCL2-07      VLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSMSGKFEEVEVD
A0A7N6A4C8_BCL2-01      QHCRRLPPSDPHAALHRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQR
A0A3Q1IAB0_BCL2L10      ------PPSESAAAMRRLAQDMEKQHQVRFHSLAQTFLKQCGPDPCS---
A0A3Q1GZ93_BCL2L1-      LRQQRLPSTTSLDAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQ
A0A3Q1JZ46_BCL2L1-      ------PPCKSMEAVKTALRDSADEFELLFTQAFSDLSSQLDVTPDTAYQ
A0A3Q1GX28_MCL1-02      -----VDVSSCPAGDEVLENDTRQLLS--QFLQDFSGLTKPRWCETKELS
A0A3Q1GX28_MCL1-01      -----VDVSSCPAGDEVLENDTRQLLS--QFLQDFSGLTKPRWCETKELS
A0A7N6A4C8_BCL2-03      VLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSMSGKFEEVEVD
A0A7N6A4C8_BCL2-04      VLCISVDVSSDYSQVESVIKQ---HFTPDSTIAKCWPYF-----------
A0A7N6A4C8_BCL2-06      VLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSMSGKFEEVEVD
A0A7N6A4C8_BCL2-02      VLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSMSGKFEEVEVD
A0A7N6A4C8_BCL2-05      VLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSMSGKFEEVEVD
                                           .:                             

A0A7N6A4C8_BCL2-07      CFKIIT--------------------------------------------
A0A7N6A4C8_BCL2-01      RFAEVID-------------------------------------------
A0A3Q1IAB0_BCL2L10      SLRKVME-------------------------------------------
A0A3Q1GZ93_BCL2L1-      SFENVMD-------------------------------------------
A0A3Q1JZ46_BCL2L1-      SFKSVMD-------------------------------------------
A0A3Q1GX28_MCL1-02      TMKRVVN----------------------------------------DVL
A0A3Q1GX28_MCL1-01      TMKRVVN----------------------------------------DVL
A0A7N6A4C8_BCL2-03      CFKKLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQVGLFGYTAY
A0A7N6A4C8_BCL2-04      -HQKLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQVGLFGYTAY
A0A7N6A4C8_BCL2-06      CFK-----------------------------------------------
A0A7N6A4C8_BCL2-02      CFKKLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQVGLFGYTAY
A0A7N6A4C8_BCL2-05      CFKKLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQVGLFGYTAY
                                                                          

A0A7N6A4C8_BCL2-07      ------------------------------------------------MG
A0A7N6A4C8_BCL2-01      -------------------------------ELFRDG-VNWGRI----IA
A0A3Q1IAB0_BCL2L10      -------------------------------ELVGDGHMNWGRV----VS
A0A3Q1GZ93_BCL2L1-      -------------------------------EVFRDG-VNWGRI----VG
A0A3Q1JZ46_BCL2L1-      -------------------------------ELFKDG-VNWGRI----VG
A0A3Q1GX28_MCL1-02      EKHRYAYNGMINKLSLDDKVDDVSFITAVAQSLFSDGTTNWGRI----AS
A0A3Q1GX28_MCL1-01      EKHRYAYNGMINKLSLDDKVDDVSFITAVAQSLFSDGTTNWGRI----AS
A0A7N6A4C8_BCL2-03      SPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETK
A0A7N6A4C8_BCL2-04      SPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETK
A0A7N6A4C8_BCL2-06      -----------------IKPYNIYVTVAYPPDTDTPGLAEENKTKPLETK
A0A7N6A4C8_BCL2-02      SPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETK
A0A7N6A4C8_BCL2-05      SPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETK
                                                                          

A0A7N6A4C8_BCL2-07      LFR-----------------------------------------------
A0A7N6A4C8_BCL2-01      FFEFGGTVCVECASKEEMTP---------------QVNNIAEWM------
A0A3Q1IAB0_BCL2L10      LFTFTGVLARQMLEQKDKKPGLDLGKGQELGQEPGQCRGLAETI------
A0A3Q1GZ93_BCL2L1-      LFAFGGALCVECVEKEMSQ----------------LVGRIVEWM------
A0A3Q1JZ46_BCL2L1-      LFAFGGVLCVECVEKNMSE----------------LVSRIADWM------
A0A3Q1GX28_MCL1-02      LVAFGAAVCQHLKEKHREN----------------CVDLVAQEI------
A0A3Q1GX28_MCL1-01      LVAFGAAVCQHLKEKHREN----------------CVDLVAQEI------
A0A7N6A4C8_BCL2-03      LISETSGVCQ------PDQ----------------VAKIIVRDAVQGNFN
A0A7N6A4C8_BCL2-04      LISETSGVCQ------PDQ----------------VAKIIVRDAVQGNFN
A0A7N6A4C8_BCL2-06      LISETSGVCQ------PDQ----------------VAKIIVRDAVQGNFN
A0A7N6A4C8_BCL2-02      LISETSGVCQ------PDQ----------------VAKIIVRDAVQGNFN
A0A7N6A4C8_BCL2-05      LISETSGVCQ------PDQ----------------VAKIIVRDAI-----
                        :.                                                

A0A7N6A4C8_BCL2-07      --------------------------------------------------
A0A7N6A4C8_BCL2-01      -----TEYLNGPLHSWIQDNGGWD--------------------------
A0A3Q1IAB0_BCL2L10      -----ADYLGEEKKDWLLENDGWE--------------------------
A0A3Q1GZ93_BCL2L1-      -----TVYLDNHIQPWIQSQGGWE--------------------------
A0A3Q1JZ46_BCL2L1-      -----TMYLDEHISPWIQSQGGWD--------------------------
A0A3Q1GX28_MCL1-02      -----SSYLLSAQRDWLVRNNSWDG-------------------------
A0A3Q1GX28_MCL1-01      -----SSYLLSAQRDWLVRNNSWDG-------------------------
A0A7N6A4C8_BCL2-03      SSVGPDGYMLSALTCGMSPVTSITEGLQQIITMGLFR-------------
A0A7N6A4C8_BCL2-04      SSVGPDGYMLSALTCGMSPVTSITEGLQQIITMGLFR-------------
A0A7N6A4C8_BCL2-06      SSVGPDGYMLSALTCGMSPVTSITEGLQQIITMGLFR-------------
A0A7N6A4C8_BCL2-02      SSVGPDGYMLSALTCGMSPVTSITEGLQQDAFVDLYDRQRESVFSCSWSS
A0A7N6A4C8_BCL2-05      ----------------------ITMGLFR---------------------
                                                                          

A0A7N6A4C8_BCL2-07      ---TIALFYLGSFDSIVRRCMIQREQSKAADKRE---------------
A0A7N6A4C8_BCL2-01      ---AFVDLYDRQRESVFSCSWSSIKTVFGLAALGAASLTIGAYLAQK--
A0A3Q1IAB0_BCL2L10      ---GFCKF---SCSAREVSQDSSMKRALFAAAGVGLAGLTFLLVR----
A0A3Q1GZ93_BCL2L1-      ---RFAELFGHDAAAEGRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
A0A3Q1JZ46_BCL2L1-      ---CFAEIFGQDAAAEARRSREALRRWLLVGVVLLTGVLLGVLIAKKR-
A0A3Q1GX28_MCL1-02      ---FVEFFRVADPESTVRKSLMAFAGLAGIGASLALLISAVRLQPLHLH
A0A3Q1GX28_MCL1-01      ---FVEFFRVADPESTVRKSLMAFAGLAGIGASLALLISSCSVM-----
A0A7N6A4C8_BCL2-03      ---TIALFYLGSFDSIVRRCMIQREQSKAADKRE---------------
A0A7N6A4C8_BCL2-04      ---TIALFYLGSFDSIVRRCMIQREQSKAADKRE---------------
A0A7N6A4C8_BCL2-06      ---TIALFYLGSFDSIVRRCMIQREQSKAADKRE---------------
A0A7N6A4C8_BCL2-02      IKTVFGLAALGAASLTIGAYLAQK-------------------------
A0A7N6A4C8_BCL2-05      ---TIALFYLGSFDSIVRRCMIQREQSKAADKRE---------------
                            .                                            

© 1998-2022Legal notice