Dataset for protein BCL-2-like of organism Anabas testudineus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1GX28_MCL1-01      MLPSGRTAMKLATGGMSCLMLPQNGVVEYSSGVNSPQITMSSSIDACNGN
A0A3Q1GX28_MCL1-02      MLPSGRTAMKLATGGMSCLMLPQNGVVEYSSGVNSPQITMSSSIDACNGN
A0A3Q1IAB0_BCL2L10      ---------------------------MFQLSWGLFLLEAESADKCADAE
A0A3Q1GZ93_BCL2L1-      -------------------MSQNRELVVFYITYKL---------------
A0A3Q1JZ46_BCL2L1-      ---------------MEEMSNSNRELVEFFIMYKL---------------
                                                    :                     

A0A3Q1GX28_MCL1-01      AALKRPKNLDVSSSNGYATKNIGANSDDIEDGSLPCTPELMSDSEVDVSS
A0A3Q1GX28_MCL1-02      AALKRPKNLDVSSSNGYATKNIGANSDDIEDGSLPCTPELMSDSEVDVSS
A0A3Q1IAB0_BCL2L10      GKLRVHRG---SPSAVRMCREQTDIAGRKMSCGLWKDTLALAEDYLSLCC
A0A3Q1GZ93_BCL2L1-      ----SQRN---YPLNHLGLNETPNRTDGGEDGLSEEQRIATHANGTFNGR
A0A3Q1JZ46_BCL2L1-      ----SQRN---HPASLLRPDDT---------GGVGDRPNSAAANGLPVSR
                              ..    .       :                      .      

A0A3Q1GX28_MCL1-01      CPAGDEVLENDTRQLLSQFLQDFSGLTKPRWCETKELSTMKRVVNDVLEK
A0A3Q1GX28_MCL1-02      CPAGDEVLENDTRQLLSQFLQDFSGLTKPRWCETKELSTMKRVVNDVLEK
A0A3Q1IAB0_BCL2L10      TSP----------------WPAPP-------PPSESAAAMRRLAQDMEKQ
A0A3Q1GZ93_BCL2L1-      SPG----------------TPPASPLRQQRLPSTTSLDAVKEALRDSANE
A0A3Q1JZ46_BCL2L1-      SGE----------------LGNSS-------PPCKSMEAVKTALRDSADE
                                               .           .  ::.   .*  .:

A0A3Q1GX28_MCL1-01      HRYAYNGMINKLSLDDKVDDVS---FITAVAQSLFSDGTTNWGRIASLVA
A0A3Q1GX28_MCL1-02      HRYAYNGMINKLSLDDKVDDVS---FITAVAQSLFSDGTTNWGRIASLVA
A0A3Q1IAB0_BCL2L10      HQVRFHSLAQTFLKQCGPDPCS---SLRKVMEELVGDGHMNWGRVVSLFT
A0A3Q1GZ93_BCL2L1-      FELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDG-VNWGRIVGLFA
A0A3Q1JZ46_BCL2L1-      FELLFTQAFSDLSSQLDVTPDTAYQSFKSVMDELFKDG-VNWGRIVGLFA
                        .   :    . :  :      :    :  * :.:. **  ****:..*.:

A0A3Q1GX28_MCL1-01      FGAAVCQHLKEKHREN----------------CVDLVAQEISSYLLSAQR
A0A3Q1GX28_MCL1-02      FGAAVCQHLKEKHREN----------------CVDLVAQEISSYLLSAQR
A0A3Q1IAB0_BCL2L10      FTGVLARQMLEQKDKKPGLDLGKGQELGQEPGQCRGLAETIADYLGEEKK
A0A3Q1GZ93_BCL2L1-      FGGALCVECVEKEMSQ----------------LVGRIVEWMTVYLDNHIQ
A0A3Q1JZ46_BCL2L1-      FGGVLCVECVEKNMSE----------------LVSRIADWMTMYLDEHIS
                        * ..:.    *:  .:                    :.: :: ** .   

A0A3Q1GX28_MCL1-01      DWLVRNNSWDGFVEFF------RVADPESTVRKSLMAFAGLAGIGASLAL
A0A3Q1GX28_MCL1-02      DWLVRNNSWDGFVEFF------RVADPESTVRKSLMAFAGLAGIGASLAL
A0A3Q1IAB0_BCL2L10      DWLLENDGWEGFCKF---SCSAREVSQDSSMKRALFAAAGVG-LAGLTFL
A0A3Q1GZ93_BCL2L1-      PWIQSQGGWERFAELFGHDAAAEGRRSQESFKKWLLAGMTLV-TGVVVGS
A0A3Q1JZ46_BCL2L1-      PWIQSQGGWDCFAEIFGQDAAAEARRSREALRRWLLVGVVLL-TGVLLGV
                         *:  :..*: * ::             .:... *:.   :   .     

A0A3Q1GX28_MCL1-01      LISSCSVM-----
A0A3Q1GX28_MCL1-02      LISAVRLQPLHLH
A0A3Q1IAB0_BCL2L10      LVR----------
A0A3Q1GZ93_BCL2L1-      LIAQKRL------
A0A3Q1JZ46_BCL2L1-      LIAKKR-------
                        *:           

© 1998-2022Legal notice