Dataset for protein BCL-2-like of organism Anabas testudineus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                            :                           ..    .       :         
---------------m---mlpqrgvvefssgynl------s----------l-sqrn---spsngyatkntgansddie
mlpsgrtamklatgg-scl---nnel-vyyitvkspqitms-sidacngnaa-krpkgldvyslsvlrprei--------
                eemsss---- m qlswg flleae adkcadaegk rvh     h aalrmlndqtnrtgrkm
                    nq       f m                                 h gcd  pdia gg 
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             .                             .           .  ::.   .*  .:.   :    .
dgslpctpelmsdsgvdvssspa----------------lqdfs-l---r-pptkslsamkrvvrDvlekhryryngmis
-cgvwkrtnataanelsngrcspgdevlendtrqllsqfwppspg-tkp-wcestemetvrtaln sanefelaftsafn
s lsgeqrlslhedytplcctgg                tgnp p rqq l sce ad   elaq mekq qvl hrlaq
    edd i a     f     e                  aa              a          d      aq   
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :  :      :    :  * :.:. **  ****:..*.:* ..:.    *:  .:                    :.: 
klslqlkvdpvs---sitaVmqelfsDG-vNWGRivsLfaFggalcvhlvEkhrsn----------------lvdrvaqw
dflsddhptddtayqffrs adsvvr  tt    vag vt tavvaqeck qnmeqpgldlgkgqelgqepgccslivee
t hn cgi  c     lkn  e   k  hm                rqml  kdkk                q rgl dt
   k  d   a      ek      g                           e                  g     
                                                                                

       250       260       270       280       290       300       310   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
:: ** .    *:  :..*: * ::             .:... *:.   :   .     *:           
itsYLlshqrdWlvsnngWdgFveff-----arvrrsestvrkwLmagagla-tgvslglLis-kr-------
msv  deaisp iqrqgs er akl-gqdaa-egadpresmkrs lvfvvvvgiaalvav vas--lqplhlh
 am  gnekq   le   c c i  hscs  evsqq al  a f amt l l gvtfs  rqvsvm     
  d      k                       a   d  f          g           kc        
                                                               a         
© 1998-2022Legal notice