Dataset for protein BCL-2-like of organism Anabas testudineus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
                                  *                        .                    
lsstitdwlfinswwlllpfi---mlvsgyityk ------------ngvveyssqrnsaqitmsssit-----aalkrg
               memmsssnre-pekrtsmg atggmecamlcqdaegklrvgvgy wsvlrpredacntn----gp
                 eannq  - -v qlmw  f lea s dk a        k  h snhrmlqdqtnragrkmsnl
                   mec  n  m f ch                      h    agfhdcn epdi dg enc 
                                                             a    d       d ad  

       170       180       190       200       210       220       230       240
knldvsssngya k ------daan-l---rselwpppspqrqrrl sckcmegmrraenesadlhslrqfrqdfdpsrk
v              wvqtps----y-svs-p--vgnnp lh q     epld lht aq ---q tvlfqqlktwmyn-
l              gkprnplhvrrtrngs-sgtaaai          d h    e    mgnh qrdshpdaqtfhk 
               eed l a    cplac pel                a          ek      ai   e  f 
               ad  i       f      d                                             

       250       260       270       280       290       300       310       320
p--c--k-ystlq----                                        dvlekhry yn mink sldd v
-yv-sd- lq-hesitn                                                               
chpd cs qrr an i                                                                
 dl  a       i                                                                  
  i          e                                                                  

       330       340       350       360       370       380       390       400
ddvsfit vaqs--r- tt-----    ag vt--av-a-hlksqeme-                l--l--qeii     
           -vv-  h-    v    ma  r  --  rqml  n--t                ccs-l ---      
              k   m         i   e   t     a  kemk                - rn  dt       
              g                               dke                  ng           

       410       420       430       440       450       460       470       480
     -s -dehqr--i-s----eg  frdafvd yd                vvveifg-qpslegssywmamaglal-
     sv  nnpisp -vrqn  -m                            r gka--rara vfgcqre l-----v
     am  ggekqs  le d                                g cd adq c  re a qa krtvffl
      e      k    d                                  c      h     a   d  i ka   
      d      h                                       a                          

 mtgg agtlcl m     
  l      i a l     
  g      a         
© 1998-2022Legal notice