Dataset for protein Mcl-1 of organism Amphilophus citrinellus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q0R633_MCL1-01      ------------------------------SLPF------------TSPD
A0A3Q0R633_MCL1-03      MNTCTMRNCRMGSYKNVMDLFLPQNGVVDGTMHYGSGNSSPQDATGTPKD
                                                      :: :            *. *

A0A3Q0R633_MCL1-01      SNGTPKRPNNLGVVSTNGYAPKNITDDVEDGSLPSTPEFHSDSESDEALE
A0A3Q0R633_MCL1-03      SNGTPKRPNNLGVVSTNGYAPKNITDDVEDGSLPSTPEFHSDSESDEALE
                        **************************************************

A0A3Q0R633_MCL1-01      RETKSLITSFFRDFTGLSQRRWKESEALKTMKRVVADVLEKHRYAYNGMV
A0A3Q0R633_MCL1-03      RETKSLITSFFRDFTGLSQRRWKESEALKTMKRVVADVLEKHRYAYNGMV
                        **************************************************

A0A3Q0R633_MCL1-01      NKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEK
A0A3Q0R633_MCL1-03      NKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEK
                        **************************************************

A0A3Q0R633_MCL1-01      GRDNCVELVSQEISTYLLSDQRDWLVKNNAWDGFVEFFRVADPESTVRNT
A0A3Q0R633_MCL1-03      GRDNCVELVSQEISTYLLSDQRDWLVKNNAWDGFVEFFRVADPESTVRNT
                        **************************************************

A0A3Q0R633_MCL1-01      LMAFAGFAGIGATLALLIR
A0A3Q0R633_MCL1-03      LMAFAGFAGIGATLALLIR
                        *******************

© 1998-2020Legal notice