Dataset for protein Mcl-1 of organism Amphilophus citrinellus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              :: :            *. *******************************
------------------------------tmpy------------TspDSNGTPKRPNNLGVVSTNGYAPKNITDDVED
mntctmrncrmgsyknvmdlflpqngvvdgslhfgsgnsspqdatg pk                               

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
GSLPSTPEFHSDSESDEALERETKSLITSFFRDFTGLSQRRWKESEALKTMKRVVADVLEKHRYAYNGMVNKLSLDERGE
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
DVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEKGRDNCVELVSQEISTYLLSDQRDWLVKNNAWDGFVEFFRV
                                                                                

       250       260         
....:....|....:....|....:....
*****************************
ADPESTVRNTLMAFAGFAGIGATLALLIR
                             
© 1998-2020Legal notice