Dataset for protein Mcl-1 of organism Ailuropoda melanoleuca

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1L3L7_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGGXSGGRLLASGKEATARREIGGGEAGAVIGGSA
G1L3L7_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGGXSGGRLLASGKEATARREIGGGEAGAVIGGSA
                    ************************************************************

G1L3L7_MCL1-02      GASPPAXXXXXXXXXXXXXGAEGPDVTATPPRLLFLEPTRRASPPEEMEGPAADAIMSPE
G1L3L7_MCL1-01      GASPPX-------------GAEGPDVTATPPRLLFLEPTRRASPPEEMEGPAADAIMSPE
                    *****              *****************************************

G1L3L7_MCL1-02      EELDGYEPEPLGKRPAVLPLLELVGEASGGPCTDGSLPSTPPPAEEEEDELYRQSLEIIS
G1L3L7_MCL1-01      EELDGYEPEPLGKRPAVLPLLELVGEASGGPCTDGSLPSTPPPAEEEEDELYRQSLEIIS
                    ************************************************************

G1L3L7_MCL1-02      RYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDV
G1L3L7_MCL1-01      RYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDV
                    ************************************************************

G1L3L7_MCL1-02      KSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQEGCIEPLAESITDVLVRTKR
G1L3L7_MCL1-01      KSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQEGCIEPLAESITDVLVRTKR
                    ************************************************************

G1L3L7_MCL1-02      DWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
G1L3L7_MCL1-01      DWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                    ***********************************************

© 1998-2020Legal notice