Dataset for protein Mcl-1 of organism Ailuropoda melanoleuca

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1L3L7_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGAASSGGRLLASGKEATARREIGGGEAGAVIGGS
G1L3L7_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGAASSGGRLL------------------------
                    ************************************                        

G1L3L7_MCL1-01      AGASPPATLAPDARRVARPSPIGAEGPDVTATPPRLLFLEPTRRASPPEEMEGPAADAIM
G1L3L7_MCL1-02      ------------------------------------------------------------
                                                                                

G1L3L7_MCL1-01      SPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPCTDGSLPSTPPPAEEEEDELYRQSLE
G1L3L7_MCL1-02      ------------------------------------------------------------
                                                                                

G1L3L7_MCL1-01      IISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
G1L3L7_MCL1-02      ---------ATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
                             ***************************************************

G1L3L7_MCL1-01      DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQEGCIEPLAESITDVLVR
G1L3L7_MCL1-02      DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQEGCIEPLAESITDVLVR
                    ************************************************************

G1L3L7_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
G1L3L7_MCL1-02      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                    **************************************************

© 1998-2022Legal notice