Dataset for protein Mcl-1 of organism Ailuropoda melanoleuca

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|G1L3L7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGAASSGGRLLASGKEATARREIGGGEAGAVIGGSAGASPPATLAPDARRVARPS
PIGAEGPDVTATPPRLLFLEPTRRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPCTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQEGCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|G1L3L7_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGAASSGGRLLATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQEGCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2021Legal notice