Dataset for protein Bak1 of organism Castor canadensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A250YC64_BAK1-02      MASGQGPGPPKEGLEEPSSDSTSEQQVVQDTEEVFRSYVFYRHQQEQEAQ
A0A250YC64_BAK1-01      MASGQGPGPPKEGLEEPSSDSTSEQQVVQDTEEVFRSYVFYRHQQEQEAQ
A0A250YC64_BAK1-03      MASGQGPGPPKEGLEEPSSDSTSEQQVVQDTEEVFRSYVFYRHQQEQEAQ
                        **************************************************

A0A250YC64_BAK1-02      GAAAPADPELVSLPQEPNSTMGQVGRRLAIIGDDINRRYDTEFQTMLQQL
A0A250YC64_BAK1-01      GAAAPADPELVSLPQEPNSTMGQVGRRLAIIGDDINRRYDTEFQTMLQQL
A0A250YC64_BAK1-03      GAAAPADPELVSLPQEPNSTMGQVGRRLAIIGDDINRRYDTEFQTMLQQL
                        **************************************************

A0A250YC64_BAK1-02      RPTAENASELFTKIASSLFDSGISWGRVVALLSFGYRLAVHVYQRGLTGF
A0A250YC64_BAK1-01      RPTAENASELFTKIASR---------------------------------
A0A250YC64_BAK1-03      RPTAENASELFTKIASR---------------------------------
                        ****************                                  

A0A250YC64_BAK1-02      LGQVTYFVIDVMLRHYITRWIAQRGGWVAALELGNGPIRNVVIVLAVVLL
A0A250YC64_BAK1-01      --CTAWPLCPLSRHHPCMQWAPWSGH--TSLAVSGGSVLTHMWSLSPLLC
A0A250YC64_BAK1-03      --PAATPTVCLT-------------------VASAGAV----WWLS----
                           .:     :                      . *.:      *:    

A0A250YC64_BAK1-02      GQFVVRRFFKS
A0A250YC64_BAK1-01      INS--------
A0A250YC64_BAK1-03      -----------
                                   

© 1998-2020Legal notice