Dataset for protein Bak1 of organism Castor canadensis

[Download (right click)] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A250YC64_BAK1-03      MASGQGPGPPKEGLEEPSSDSTSEQQVVQDTEEVFRSYVFYRHQQEQEAQ
A0A250YC64_BAK1-01      MASGQGPGPPKEGLEEPSSDSTSEQQVVQDTEEVFRSYVFYRHQQEQEAQ
A0A250YC64_BAK1-02      MASGQGPGPPKEGLEEPSSDSTSEQQVVQDTEEVFRSYVFYRHQQEQEAQ
                        **************************************************

A0A250YC64_BAK1-03      GAAAPADPELVSLPQEPNSTMGQVGRRLAIIGDDINRRYDTEFQTMLQQL
A0A250YC64_BAK1-01      GAAAPADPELVSLPQEPNSTMGQVGRRLAIIGDDINRRYDTEFQTMLQQL
A0A250YC64_BAK1-02      GAAAPADPELVSLPQEPNSTMGQVGRRLAIIGDDINRRYDTEFQTMLQQL
                        **************************************************

A0A250YC64_BAK1-03      RPTAENASELFTKIASRPA-------------------------------
A0A250YC64_BAK1-01      RPTAENASELFTKIASRCT-------------------------------
A0A250YC64_BAK1-02      RPTAENASELFTKIASSLFDSGISWGRVVALLSFGYRLAVHVYQRGLTGF
                        ****************                                  

A0A250YC64_BAK1-03      -----ATPTVCLT----------------------------------VAS
A0A250YC64_BAK1-01      -----AWPLCPLSRHHPCMQWAPWSGH--TSLAVSGGSVLTHMWSLSPLL
A0A250YC64_BAK1-02      LGQVTYFVIDVMLRHYI-TRWIAQRGGWVAALELGNGPIRNVVIVLAVVL
                                   :                                      

A0A250YC64_BAK1-03      AGA----VWWLS
A0A250YC64_BAK1-01      --------CINS
A0A250YC64_BAK1-02      LGQFVVRRFFKS
                                   *

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice