Dataset for protein Bak1 of organism Castor canadensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MASGQGPGPPKEGLEEPSSDSTSEQQVVQDTEEVFRSYVFYRHQQEQEAQGAAAPADPELVSLPQEPNSTMGQVGRRLAI
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************                                     .:     
IGDDINRRYDTEFQTMLQQLRPTAENASELFTKIASr-----------------------------------qvaypvvp
                                    slfdsgiswgrvvallsfgyrlavhvyqrgltgflgpttwftid
                                                                        ca t lcc

       170       180       190       200       210 
....:....|....:....|....:....|....:....|....:....|.
:                      . *.:      *:               
lt--h----w----g-----lvvsnGsv----wwLs--l------------
vsrr-yitr-ipws-hwvts-elgg pirtvviv avv-liqsvvrrffks
 mlh pcmq aaqr g  aa aa a a lnhm s  pl cgnf        
© 1998-2020Legal notice