Dataset for protein BAX-like of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7ICC2_BAK1-02      MGLCHSWELGRPGGSCPSLMAAPLSCWAPTPIQDLVSFLFSPCLPLVPEPSIHVLEHCRG
F6SBR3_BOK-01       ------MEVLRRSSVFAAEIMD-------------------------AFDRSPTDKELVA
F6SBR3_BOK-02       ------MEVLRRSSVFAAEIMD-------------------------AFDRSPTDKELVA
F7ICC2_BAK1-03      ------MASGQGPGPPRQECGE-------------------------PDPPSASEEQVAR
F7ICC2_BAK1-04      ------MASGQGPGPPRQECGE-------------------------PDPPSASEEQVAR
F7ICC2_BAK1-01      ------MASGQGPGPPRQECGE-------------------------PDPPSASEEQVAR
                              .  .                                 .       :    

F7ICC2_BAK1-02      SPRRGAQGHGQLGQKPSAMMQALAPTAWPPAHLPASRSHSTMGQVGRQLAIIGDDINRRY
F6SBR3_BOK-01       QAKALGREYVHARLLRAGLSWSAPERAAPFPGRLA-EVCAVLLRLGDELEMIRPSVYRNV
F6SBR3_BOK-02       QAKALGREYVHARLLRAGLSWSAPERAAPFPGRLA-EVCAVLLRLGDELEMIRPSVYRNV
F7ICC2_BAK1-03      DTEEVFHSYVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAIIGDDINRRY
F7ICC2_BAK1-04      DTEEVFHSYVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAIIGDDINRRY
F7ICC2_BAK1-01      DTEEVFHSYVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAIIGDDINRRY
                    ..    . :            . .  * *     :    :.: .:* :* :*  .: *. 

F7ICC2_BAK1-02      DSEFQTMLQHLQPTAENAYEYFTKIASSL---FESGINWGRVVALLGFGYRLALHVYQRG
F6SBR3_BOK-01       ARQLHISLQS-EPVVTDA---FLAVAGHI---FSAGITWGKVVSLYAVAAGLAVDCVRQA
F6SBR3_BOK-02       ARQLHISLQS-EPVVTDA---FLAVAGHI---FSAGMPSLPIPWDLREGSGVCGSVLQGP
F7ICC2_BAK1-03      DSEFQTMLQHLQPTAENAYEYFTKIASRP-------------------------------
F7ICC2_BAK1-04      DSEFQTMLQHLQPTAENAYEYFTKIASRYPDHLPAGL-WSLSCPVTTSPWP---------
F7ICC2_BAK1-01      DSEFQTMLQHLQPTAENAYEYFTKIASSL---FESGINWGRVVALLGFGYRLALHVYQRG
                      :::  **  :*.. :*   *  :*.                                 

F7ICC2_BAK1-02      LTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALDL---GNGPILNVLVVLGVVLLGQF
F6SBR3_BOK-01       QPAMVHALVDCLGEFVRKTL-ATWLRRRGGWTDVLKCVVNTDPGLRSHWLLAALCSFGRF
F6SBR3_BOK-02       HEPAPAHPGAAQCSLVLSRC-CRCLELPSDQCGSSGLKLQHSGSLVVLWVGG---HAGQL
F7ICC2_BAK1-03      --------------------------ATPTACLRVAS---TGAVWWLSWALATVWPYTST
F7ICC2_BAK1-04      -------------AYMMHSWPGRHLLSVSSVCCELTC---GLGLLFFSLRVPDSFVFCAL
F7ICC2_BAK1-01      LTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALDL---GNGPILNVLVVLGVVLLGQF
                                                                                

F7ICC2_BAK1-02      VVRRFFKS----
F6SBR3_BOK-01       LKAAFFVLLPER
F6SBR3_BOK-02       AQAS--------
F7ICC2_BAK1-03      SAA---------
F7ICC2_BAK1-04      AHSSFQH-----
F7ICC2_BAK1-01      VVRRFFKS----
                                

© 1998-2020Legal notice