Dataset for protein BAX-like of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7ICC2_BAK1-02      MGLCHSWELGRPGGSCPSLMAAPLSCWAPTPIQDLVSFLFSPCLPLVPEPSIHVLEHCRG
F6SBR3_BOK-01       ------MEVLRRSSVFAAEIMDA-------------------------FDRSPTDKELVA
F6SBR3_BOK-02       ------MEVLRRSSVFAAEIMDA-------------------------FDRSPTDKELVA
F7ICC2_BAK1-01      ------MASGQGPGPPRQECGEP-------------------------DPPSASEEQVAR
F7ICC2_BAK1-03      ------MASGQGPGPPRQECGEP-------------------------DPPSASEEQVAR
F7ICC2_BAK1-04      ------MASGQGPGPPRQECGEP-------------------------DPPSASEEQVAR
                              .  .        .                                :    

F7ICC2_BAK1-02      SPRRGAQGHGQLGQKPSAMMQALAPTAWPPAHLPASRSHSTMGQVGRQLAIIGDDINRRY
F6SBR3_BOK-01       QAKALGREYVHARLLRAGLSWSAPERAAPFPGRLA-EVCAVLLRLGDELEMIRPSVYRNV
F6SBR3_BOK-02       QAKALGREYVHARLLRAGLSWSAPERAAPFPGRLA-EVCAVLLRLGDELEMIRPSVYRNV
F7ICC2_BAK1-01      DTEEVFHSYVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAIIGDDINRRY
F7ICC2_BAK1-03      DTEEVFHSYVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAIIGDDINRRY
F7ICC2_BAK1-04      DTEEVFHSYVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAIIGDDINRRY
                    ..    . :            . .  * *     :    :.: .:* :* :*  .: *. 

F7ICC2_BAK1-02      DSEFQTMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTG
F6SBR3_BOK-01       ARQLHISLQS-EPVVTDA---FLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPA
F6SBR3_BOK-02       ARQLHISLQS-EPVVTDA---FLAVAGHIFSAGMPSLPIPWDLREGSGVCGSVLQGPHEP
F7ICC2_BAK1-01      DSEFQTMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTG
F7ICC2_BAK1-03      DSEFQTMLQHLQPTAENAYEYFTKIAS--------------------R------------
F7ICC2_BAK1-04      DSEFQTMLQHLQPTAENAYEYFTKIAS--------------------RYPDHLPAGLWSL
                      :::  **  :*.. :*   *  :*.                                 

F7ICC2_BAK1-02      FLGQVTRFVVDFMLHHCIARWIAQRGGWVAALDL---GNGPILNVLVVLGVVLLGQFVVR
F6SBR3_BOK-01       MVHALVDCLGEFVRKTL-ATWLRRRGGWTDVLKCVVNTDPGLRSHWLLAALCSFGRFLKA
F6SBR3_BOK-02       APAHPGAAQCSLVLSRC-CRCLELPSDQCGSSGLKLQHSGSLVVLWVGG---HAGQLAQA
F7ICC2_BAK1-01      FLGQVTRFVVDFMLHHCIARWIAQRGGWVAALDL---GNGPILNVLVVLGVVLLGQFVVR
F7ICC2_BAK1-03      ----------------------PATPTACLRVAS---TGAVWWLSWALATVWPYTSTSAA
F7ICC2_BAK1-04      SCPVTTSPWPAYMMHSWPGRHLLSVSSVCCELTC---GLGLLFFSLRVPDSFVFCALAHS
                                                                                

F7ICC2_BAK1-02      RFFKS----
F6SBR3_BOK-01       AFFVLLPER
F6SBR3_BOK-02       S--------
F7ICC2_BAK1-01      RFFKS----
F7ICC2_BAK1-03      ---------
F7ICC2_BAK1-04      SFQH-----
                             

© 1998-2020Legal notice