Dataset for protein BAX-like of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .  .                                 .       :    ..    . :           
------mesgrgpgpprqecge-------------------------pdppsaseeqvardteevfhsyvfyrhrqeqea
mglchswavlqrssvfaalimdplscwaptpiqdlvsflfspclplvafdriptdkelvaqakalgrehghagllragls
        l  pg scps maa                          e s hvl hcrgsprrgaqg  ql qkpsamm
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 . .  * *     :    :.: .:* :* :*  .: *.   :::  **  :*.. :*   *  :*.             
egaaapAdPemvslslqpsstmgqvGrqLaiIgddinRrydsefqtmLQhlqPtaenAyeyFtkiAssl---fsagi-wg
wslper a fpgrpa-evcavllrl de em rpsvy nvarqlhis  s-e vvtd --- lav gripdh-es--n--
qa  pt w pahl  srsh                                                hy   l-- mtss
                                                                    p    p  lp l
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rvvallgfgyrla--v-q---------------dfmlhhc-arwlaqrggwcaaldl---gngpllnvwvvlgvvllgqf
----------g--lh-y-rgltgflgqvtrfvv--v----i---i-svstvvlvvtcvvqtspviwvslrla---vftsl
pspwvytvpw-vcvscvrqpqppmvhhpvdcqgsy-rstwpgth-rrtpsqtgssksklnhlaswvsl lgptswsycrt
licsdtrsasp  gd l gaheaapaalgaalcel mksl c c llp da dr g     g l rlh a gdlfpa a 
k  p  ae a                       a    r      ea     ce a     d g ff     a ch    

       250  
....:....|..
            
vvasff------
aqrr--kslper
sks- qvl    
lh a  h     
 a          
© 1998-2020Legal notice