Dataset for protein BAX-like of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .  .        .                                :    ..    . :           
------mesgrgpgpprqecgep-------------------------dppsaseeqvardteevfhsyvfyrhrqeqea
mglchswavlqrssvfaalimdalscwaptpiqdlvsflfspclplvpfdriptdkelvaqakalgrehghagllragls
        l  pg scps maa                          e s hvl hcrgsprrgaqg  ql qkpsamm
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 . .  * *     :    :.: .:* :* :*  .: *.   :::  **  :*.. :*   *  :*.             
egaaapAdPemvslslqpsstmgqvGrqLaiIgddinRrydsefqtmLQhlqPtaenAyeyFtkiAs--f--gi-wg-vv
wslper a fpgrpa-evcavllrl de em rpsvy nvarqlhis  s-e vvtd --- lav gsl-ss--n--r--
qa  pt w pahl  srsh                                                hi ea mtslpip
                                                                          p  k  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-ll--g-rlalhvyqrgltgflgqvtrfvvdfmlhhc-arwlaqrggwcaaldl---gngpllnvwvvlgvvllgqfvva
a--gf-yg-------g----------------v----i---irsvstvvlvvtcvvqtspviwvslrla---vftslaqr
wdyrvas ypvslvr-pwspsvpvtvspwpsy-rstwpgth-prtpsqtgssksklnhlaswvsl lgptswsycrtsks
s  ae a vcgdcpaqlqplmphhpgdcqgel mksl c c llp da dr g     g l rlh a gdlfpa a lh 
          d  l  aheaacaal aalca    r      ea     ce a     d g ff     a ch     a 

         
....:....
         
sff------
r--kslper
- qvl    
a  h     
         
© 1998-2020Legal notice