Dataset for protein Bad of organism Oryzias latipes

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P9HNZ2_BAD-01      MAAKFTISDDSESSEEVEGGKLDLGAAGGGGGGEGEHLHDRHSLTLPELR
A0A3B3HDU2_BAD-01      MAAKFTISDDSESSEEVEGGKLDLGAA---AGGEGEHLHDRHSLTLPELR
A0A3P9KSL7_BAD-01      MAAKFTISDDSESSEEVEGGKLDLGAA---AGGEGEHLHDRHSLTLPELR
A0A3P9KSL7_BAD-02      MAAKFTISDDSESSEEVEGGKLDLGAA---AGGEGEHLHDRHSLTLPELR
                       ***************************   .*******************

A0A3P9HNZ2_BAD-01      LTSNGRTRLNSESTASTYSRDEDLAREDEAGTPTDGLAFRGRSKSAPPAL
A0A3B3HDU2_BAD-01      LTSNGRTRLNSESTASTYSRDEDLAREDEAGTPTDGLAFRGRSKSAPPAL
A0A3P9KSL7_BAD-01      LTSNGRTRLNSESTASTYSRDEDLAREDEAGTPTDGLAFRGRSKSAPPAL
A0A3P9KSL7_BAD-02      LTSNGRTRLNSESTASTYSRDEDLAREDEAGTPTDGLAFRGRSKSAPPAL
                       **************************************************

A0A3P9HNZ2_BAD-01      WAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSTGAAKQMLHSTSWWNYLFS
A0A3B3HDU2_BAD-01      WAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSTGAAKQMLHSTSWWNYLFS
A0A3P9KSL7_BAD-01      WAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSTGAAKQMLHSTSWWNYLFS
A0A3P9KSL7_BAD-02      WAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSTGAAKQMLHSTSWWNYLFS
                       **************************************************

A0A3P9HNZ2_BAD-01      HPEAEGEYSHHESQRTE---------------------------------
A0A3B3HDU2_BAD-01      HPEAEGEYSHHESHRTE---------------------------------
A0A3P9KSL7_BAD-01      HPEAEGEYSHHESHRTENRDLLGWLRCSSDITVSHVTAGFQLPFTRNSLF
A0A3P9KSL7_BAD-02      HPEAEGEYSHHESHRTENRDLLGWLRCSSDITVSHVTAGFQLPFTRNSLF
                       *************:***                                 

A0A3P9HNZ2_BAD-01      ------------------------------
A0A3B3HDU2_BAD-01      ------------------------------
A0A3P9KSL7_BAD-01      QGWWFDLPVQDQRRQQLQARQNFLEPSIRT
A0A3P9KSL7_BAD-02      QGWWFDLPVQDQRRQQLQR-----------
                                                     

© 1998-2020Legal notice