Dataset for protein Bad of organism Oryzias latipes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***************************   .*************************************************
MAAKFTISDDSESSEEVEGGKLDLGAA---aGGEGEHLHDRHSLTLPELRLTSNGRTRLNSESTASTYSRDEDLAREDEA
                           gggg                                                 
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
GTPTDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSTGAAKQMLHSTSWWNYLFSHPEAEGEYSH
                                                                                
                                                                                

       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***:***                                                               
HEShRTE---------------------------------------------------------------
   q   nrdllgwlrcssditvshvtagfqlpftrnslfqgwwfdlpvqdqrrqqlqrrqnflepsirt
                                                          a           
© 1998-2020Legal notice