Dataset for protein classical BH3-containing proteins of organism Oreochromis niloticus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A669C520_BCL2L11      YLFENADMQADCGLRIYFWLFLCDAAEVTLGLPHAFPIRQTEMYLPPVGA
I3K2D6_BMF-01           -----------------------MDDEEDDVFEPKANCWRTTFREIKCEH
I3K7B6_BAD-01           --------------------------------------MAANFTISDSES
                                                                : :       

A0A669C520_BCL2L11      TGAQT------SRLNRGSTGGGEPDSPSWCRTPKSFDVFQSRTIFRFPRR
I3K2D6_BMF-01           RGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHR
I3K7B6_BAD-01           ETSEEVG----EEENQQPAGQDQESKPQTLALPVIKTTGAGRLRLNSESH
                          ::          .  . *  :   *     .       .*  :    .

A0A669C520_BCL2L11      SSSGYFSSD---------CDSLPSSPLSPKPVMSDKAIQTPSPTGQVLIH
I3K2D6_BMF-01           ----ARRQEI----------AEQQNSMERLPRQRPAARSVEACIGQKLQL
I3K7B6_BAD-01           TSSVARDEDLMARGEDEVCTPTEGDPFRRRSKSAPPALWAAKKYGQKLRR
                               .:           .   ..:   .     *  .    ** *  

A0A669C520_BCL2L11      ALQRMGEVRGEGPGTQHGEHRLFMYNSRINVSARTWRSVTNDSEKMNKNI
I3K2D6_BMF-01           IGDQFHW------------ERLQLYHRNQRNQGPMW--------------
I3K7B6_BAD-01           MSDEFDSL------LDKGEMKLKKLHHSK-----TW--------------
                          : :               .*   :         *              

A0A669C520_BCL2L11      LRMFCYLVSYLRCVCFHPFLTVELSHEREPFFHYSDVLCLLFSHE-----
I3K2D6_BMF-01           ------------------------------WRLAAALLSLLFDRGFIAGG
I3K7B6_BAD-01           ------------------------------W-------SYLFSHQETEGE
                                                      :       . **..      

A0A669C520_BCL2L11      ------------
I3K2D6_BMF-01           GGGGRR------
I3K7B6_BAD-01           NNHLENHNQRTE
                                    

© 1998-2022Legal notice