Dataset for protein classical BH3-containing proteins of organism Oreochromis niloticus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3K2D6_BMF-01      MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNA
I3K7B6_BAD-01      ---------------MAANFTISDSESETSEEVG----EEENQQPAGQDQESKPQTLALP
                                    :.*   ..*   ::  *     ::.  *.*  :*..*   . .

I3K2D6_BMF-01      GFRLHFPARFELVGDHR----ARRQEI----------AEQQNSMERLPRQRPAARSVEAC
I3K7B6_BAD-01      VIKTTGAGRLRLNSESHTSSVARDEDLMARGEDEVCTPTEGDPFRRRSKSAPPALWAAKK
                    :.   ..*: * .: .    ** :::          . : :.: * ... *.*  .   

I3K2D6_BMF-01      IGQKLQLIGDQFHW------ERLQLYHRNQRNQGPMWWRLAAALLSLLFDRGFIAGGGGG
I3K7B6_BAD-01      YGQKLRRMSDEFDSLLDKGEMKLKKLHHSK-----TWW-------SYLFSHQETEGENNH
                    ****. :.*:*         .*:  *..:      **       * **..    * .. 

I3K2D6_BMF-01      GRR------
I3K7B6_BAD-01      LENHNQRTE
                     .      

© 1998-2020Legal notice