Dataset for protein classical BH3-containing proteins of organism Oreochromis niloticus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        : :         ::          .  . *  :   *   
--------------------------e-----------wrttfylspvestgtqt-g----srnnrqptGvgeessPswy
ylfenadmqadcglriyfwlflcmdd-vtlvlppkfpirqanmtipksghrtseev-palvpnlgqlsc qdqppr qtl
                       daa eddgfehaancma e reidc ae  p     eee mg a ga  dk lfc

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  .       .*  :    .       .:           .   ..:   .     *  .    ** *    : :     
rtpvsrtvfqsRtrlvspsr-ss-arssd---------c-stqsspmsrrpvssppArwvpspyGQkLrrmsdrfhw---
gnakikltgpg lifrgerht--vyfrqelmargedev-tplpqnslrplsrqrdk lstekkt  v qlilqqmgsvrg
al gffdh aa fe nfdh s  g  de i         daeegfe k kma a iqaaaci    ihag e del  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .*   :         *                                            :       . 
-------gemrLqmyhssq-----tW--------------------------------------------w------lsl
egpgtqk--hk kllnrrkrvsgrm rsvtndsekmnknilrmfcylvsylrcvcfhpfltvelsherepfrlysdv-cy
    ldh  e  fk  hninnqap                                               fhaaal   

       250       260  
....:....|....:....|..
**..                  
LFshq---g-------------
  drgfte-gnnhlrrhnqrte
    eeia eggggen      
© 1998-2022Legal notice