Dataset for protein Bad of organism Oncorhynchus mykiss

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A060W8P9_BAD-01      MNHTHDCVDDNPETMNEQDESDHSGTTHYPEFQLHNVSTTTSIRPRPGGR
A0A060W8W7_BAD-01      MDHIHDCVDEC--------ESDHSGTTHNSEFQLH-VSTTMSNRPRPGER
                       *:* *****:         ********* .***** **** * ***** *

A0A060W8P9_BAD-01      ARLYSESQVCSQVGRRDDTEFQDAITPTEEGGGDGAPFRSRSQSAPPTLW
A0A060W8W7_BAD-01      VRLYSESQVCSQVGKREDTEFQDVMTPTEDGGGDGASFRGRSQSAPPALW
                       .*************.*:******.:****:******.**.*******:**

A0A060W8P9_BAD-01      AAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGVKQEVSRGWFSFLWSPN
A0A060W8W7_BAD-01      AAKKYGCQLRRMSDEFDTWLDKGEPKRGISPGGGKQKVSRGWFSFLWSPK
                       ****** ************************** **:************:

A0A060W8P9_BAD-01      EAEGRE
A0A060W8W7_BAD-01      EAEGRE
                       ******

© 1998-2020Legal notice