Dataset for protein Bad of organism Oncorhynchus mykiss

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A060W8P9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus mykiss GN=BAD (length=156 residues).
MNHTHDCVDDNPETMNEQDESDHSGTTHYPEFQLHNVSTTTSIRPRPGGRARLYSESQVCSQVGRRDDTEFQDAITPTEE
GGGDGAPFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGVKQEVSRGWFSFLWSPNEAEGRE
>gnl|bcl2dbpro|A0A060W8W7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Oncorhynchus mykiss GN=BAD (length=147 residues).
MDHIHDCVDECESDHSGTTHNSEFQLHVSTTMSNRPRPGERVRLYSESQVCSQVGKREDTEFQDVMTPTEDGGGDGASFR
GRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGEPKRGISPGGGKQKVSRGWFSFLWSPKEAEGRE
© 1998-2020Legal notice