Dataset for protein Bmf of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N9CRT3_BMF-02      MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCPLSRLQLF
A0A7N9CRT3_BMF-01      MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCPLSRLQLF
A0A7N9CRT3_BMF-03      MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCPLSRLQLF
                       **************************************************

A0A7N9CRT3_BMF-02      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
A0A7N9CRT3_BMF-01      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
A0A7N9CRT3_BMF-03      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
                       **************************************************

A0A7N9CRT3_BMF-02      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHV-
A0A7N9CRT3_BMF-01      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A7N9CRT3_BMF-03      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
                       ************************************************* 

A0A7N9CRT3_BMF-02      --QQNRNRVWWQILLFLHNLALNGEENRNGAGPR------------
A0A7N9CRT3_BMF-01      QHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR------------
A0A7N9CRT3_BMF-03      QHQQNRNRVWWQILLFLHNLALNGEENRNGAGPRPLTWNGAVVKPC
                         ********************************            

© 1998-2022Legal notice