Dataset for protein Bmf of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********************************************************************   ********
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVqqhQQNRNRVW
                                                                     ---        

       170       180       190      
....:....|....:....|....:....|....:.
************************            
WQILLFLHNLALNGEENRNGAGPR------------
                        pltwngavvkpc
© 1998-2022Legal notice