Dataset for protein classical BH3-containing proteins of organism Ictidomys tridecemlineatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3LVX0_BIK-01           --------------------------------------------------
A0A287CXH0_BMF-01       MPRAGVFWKQYRAVRSGLLRRPPESAAAAGPASGSRLPGSGVSLPQVFIT
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A287CXH0_BMF-02       --------------------------------------------------
A0A287CT05_BAD-02       --------------------------------------------------
A0A287CT05_BAD-01       --------------------------------------------------
                                                                          

I3LVX0_BIK-01           --------------------------------------------------
A0A287CXH0_BMF-01       LDPGAEPWHHDSEAETLSWSHPGEMEPPQCVEELEDDVFQPEDGEPGTQP
A0A287DFJ0_BCL2L11      --------------------MAKQPSDVSSECDREGGQLQPAERPPQLRP
A0A287DFJ0_BCL2L11      --------------------MAKQPSDVSSECDREGGQLQPAERPPQLRP
A0A287CXH0_BMF-02       -------------------VFPEEMEPPQCVEELEDDVFQPEDGEPGTQP
A0A287CT05_BAD-02       -------------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRR
A0A287CT05_BAD-01       -------------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRR
                                                                          

I3LVX0_BIK-01           --------MVQGSHQVALRLACIGDEMDLCFQDLQLA-------------
A0A287CXH0_BMF-01       GSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQE----------
A0A287DFJ0_BCL2L11      G-------APTSLQTEPQ--------------------------------
A0A287DFJ0_BCL2L11      G-------APTSLQTEPQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRS
A0A287CXH0_BMF-02       GSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQE----------
A0A287CT05_BAD-02       GWHPA---WTQSMFQIPEFEPSEQEDSSSAEGGLGPSPAG----------
A0A287CT05_BAD-01       GWHPA---WTQSMFQIPEFEPSEQEDSSSAEGGLGPSPAG----------
                                   .    .                                 

I3LVX0_BIK-01           ------------------------QLPGMAMHSLALSYSQARVTGVLRSL
A0A287CXH0_BMF-01       ------------------------DKATQTLSPASPSQGVMLPCGVTEEP
A0A287DFJ0_BCL2L11      ------------------------DRSPAPMSCDKSTQTPSPPCQAFNHY
A0A287DFJ0_BCL2L11      PLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHY
A0A287CXH0_BMF-02       ------------------------DKATQTLSPASPSQGVMLPCGVTEEP
A0A287CT05_BAD-02       ------------------------DRPGCGLAPGLPRDTGHQQWQATSSS
A0A287CT05_BAD-01       ------------------------DRPGCGLAPGLPRDTGHQQWQATSSS
                                                : .   :              .    

I3LVX0_BIK-01           AQGLASLRENMWFWRPAAPSTR---------------------------V
A0A287CXH0_BMF-01       QRLFYGNAGYRLPLPASFPAGLPLGE--------------QPPEGQWQHR
A0A287DFJ0_BCL2L11      LSAMASMRESQ-----AEPADM--------------------RPEIW---
A0A287DFJ0_BCL2L11      LSAMASMRESQ-----AEPADM--------------------RPEIW---
A0A287CXH0_BMF-02       QRLFYGNAGYRLPLPASFPAGLPLGE--------------QPPEGQWQHR
A0A287CT05_BAD-02       NHGGAGATETR-SRHSSYPADTDLDEGMEEEPSPFRGRSRSAPPNLW---
A0A287CT05_BAD-01       NHGGAGATETR-SRHSSYPADTDLDEGMEEEPSPFRGRSRSAPPNLW---
                             .          : *:                              

I3LVX0_BIK-01           PPARACRELLPVLLLLGLLLSRALYLRLQ---------------------
A0A287CXH0_BMF-01       AEVQIARKLQCIADQFH-----RLHM------QQHQQNRNRVWWQILLFL
A0A287DFJ0_BCL2L11      ----IAQELRRIGDEFNLYYPRRVFFNNYQPEDRPQMVILRLLRCIIRLV
A0A287DFJ0_BCL2L11      ----IAQELRRIGDEFNLYYPRRVFFNNYQPEDRPQMVILRLLRCIIRLV
A0A287CXH0_BMF-02       AEVQIARKLQCIADQFH-----RLHM------QQHQQNRNRVWWQILLFL
A0A287CT05_BAD-02       AAQRYGRELRRMSDEFE-----GSFK--------------------VTFS
A0A287CT05_BAD-01       AAQRYGRELRRMSDEFE-----GSFKGLPRPRSAGTASQMRQSSSWTRFI
                              .:*  :   :        .                         

I3LVX0_BIK-01           -----------------
A0A287CXH0_BMF-01       HNLALNGDENRDRAGPR
A0A287DFJ0_BCL2L11      WRMH-------------
A0A287DFJ0_BCL2L11      WRMH-------------
A0A287CXH0_BMF-02       HNLALNGDENRDRAGPR
A0A287CT05_BAD-02       QSPFLRA----------
A0A287CT05_BAD-01       QSWWDRNLGRRGSAPSQ
                                         

© 1998-2020Legal notice