Dataset for protein classical BH3-containing proteins of organism Ictidomys tridecemlineatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                                     sh-g---- --
                                                                      f e       

        90       100       110       120       130       140       150       160
                               .    .                                           
ecdg-d-pf---d----l-- shla   aa  lfdc e--------------pq-l-pae                    
---- - --   -    -          mv  sh v  rnaeiggerdphfsd q lapp                    
                                      gl cged mcl  q    a                       

       170       180       190       200       210       220       230       240
              : .   :              .         .          : *:                    
llsrsssgyfsfdtqkstcpmacdlstdgpmpqwgvfnhsnrlgysmtgtqlsrpsaf sgmp-g-gmeeepspfrgrsr
               lapag hsaklrysghlvt  leeplhaf  aa smwplha e  tld d               
                  ma   la    qar     r laq l  l  n  fwrp a   r                  

       250       260       270       280       290       300       310       
                .:*  :   :        .                                          
spregl-qhr-ev-ygqk qcmglqlhlyyprgvhknnyqpeqrp-qvrn-vwwq-illlqrlalrgdenrdragpr
qa--ei   vpaqqac   lpva l e lls asyfrlqr rdqhtmnil llrcw----hn--dnnlgr gs psq
    --     pa         l   g        lg p   sag asqm qsss vt s--ww  a          
                                                        t  i  pf             
© 1998-2022Legal notice