Dataset for protein classical BH3-containing proteins of organism Gouania willdenowi

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5I9J2_BAD-01      -------MAANFSISDSESDPSEEVEEEDNPTRKHRIPLHLSLNLPDFGL
A0A8C5HAH2_BMF-01      -----------------MDDEEDDVFEPDPLCWRTAFK---EIKCEDRVT
A0A8C5I9J2_BAD-02      MMPFYVKMAANFSISDSESDPSEEVEEEDNPTRKHRIPLHLSLNLPDFGL
                                         .* .::* * *   ..  :    .::  *   

A0A8C5I9J2_BAD-01      TGPGRIRVNSESVSSTVSRDEEEVGTPTDGAPFR--------GRSKSAPP
A0A8C5HAH2_BMF-01      QTPGPALVHSGMLPCGVAEEPRSLFHGNAGFRLHFPAHFELVGEHQSSPP
A0A8C5I9J2_BAD-02      TGPGRIRVNSESVSSTVSRDEEEVGTPTDGAPFR--------GRSKSAPP
                         **   *:*  :.. *: :  .:   . *  :.        *  :*:**

A0A8C5I9J2_BAD-01      ------------------SLWAAKKYGQRLRRMSDEFDSLLDKGEMRKVR
A0A8C5HAH2_BMF-01      ESEEQRNTMEHLPRRPSVAHSVEARIGQKLQLIGDQFHREHLQRYHRNQR
A0A8C5I9J2_BAD-02      ------------------SLWAAKKYGQRLRRMSDEFDSLLDKGEMRKVR
                                         :  .  . **.*. :.*:*     :   *: *

A0A8C5I9J2_BAD-01      SAGSTKQMHHSKSWWSYLFSHQEMEGENNHHDGHTPERTE
A0A8C5HAH2_BMF-01      NNGPV--------WWRLAATLLGLLFDRGFIAGGGGAGRR
A0A8C5I9J2_BAD-02      SAGSTKQMHHSKSWWSYLFSHQEMEGENNHHDGHTPERTE
                       . *..        **    :   :  :...  *       

© 1998-2022Legal notice