Dataset for protein classical BH3-containing proteins of organism Gouania willdenowi

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C5HAH2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gouania willdenowi GN=BMF (length=162 residues).
MDDEEDDVFEPDPLCWRTAFKEIKCEDRVTQTPGPALVHSGMLPCGVAEEPRSLFHGNAGFRLHFPAHFELVGEHQSSPP
ESEEQRNTMEHLPRRPSVAHSVEARIGQKLQLIGDQFHREHLQRYHRNQRNNGPVWWRLAATLLGLLFDRGFIAGGGGAG
RR
>gnl|bcl2dbpro|A0A8C5I9J2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Gouania willdenowi GN=BAD (length=157 residues).
MAANFSISDSESDPSEEVEEEDNPTRKHRIPLHLSLNLPDFGLTGPGRIRVNSESVSSTVSRDEEEVGTPTDGAPFRGRS
KSAPPSLWAAKKYGQRLRRMSDEFDSLLDKGEMRKVRSAGSTKQMHHSKSWWSYLFSHQEMEGENNHHDGHTPERTE
>gnl|bcl2dbpro|A0A8C5I9J2_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Gouania willdenowi GN=BAD (length=164 residues).
MMPFYVKMAANFSISDSESDPSEEVEEEDNPTRKHRIPLHLSLNLPDFGLTGPGRIRVNSESVSSTVSRDEEEVGTPTDG
APFRGRSKSAPPSLWAAKKYGQRLRRMSDEFDSLLDKGEMRKVRSAGSTKQMHHSKSWWSYLFSHQEMEGENNHHDGHTP
ERTE
© 1998-2022Legal notice