Dataset for protein classical BH3-containing proteins of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2Z168_BMF-02       ----MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQS---LLDCP
A0A2I2Z168_BMF-01       ----MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQS---LLDCP
A0A2I2YVQ5_PMAIP1-      ----MPGKKARKNAQPSPARAPAGPAGTARDQAGFGIEMQLRFTRGKKLL
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTS--------------L
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTS--------------L
G3QCT2_BIK-01           -MSEVRPLSRDILMETLLYEQLLEPPTME----------------VLGVT
A0A2I2Z8C7_BAD-03       -MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDAS
A0A2I2Z8C7_BAD-01       -MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDAS
A0A2I2Z8C7_BAD-02       -MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDAS
A0A2I2YVQ5_PMAIP1-      -----------------------MPGKKARKNAQPSPARAPA-------E
G3QTJ6_HRK-01           ----------------------MCPCPLHRGRGPPAVCACSAGRLGLRSS
                                                                          

A0A2I2Z168_BMF-02       LSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQ
A0A2I2Z168_BMF-01       LSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQ
A0A2I2YVQ5_PMAIP1-      SSSPLALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLR
A0A2I2YQ13_BCL2L11      QTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS
A0A2I2YQ13_BCL2L11      QTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS
G3QCT2_BIK-01           DSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEV
A0A2I2Z8C7_BAD-03       HQQEQPTSSSHHGEGTSSPEERRHSNADAA--------------KLQLDA
A0A2I2Z8C7_BAD-01       HQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRS
A0A2I2Z8C7_BAD-02       HQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRS
A0A2I2YVQ5_PMAIP1-      LEVECATQLRRFGDKLNFRQKL--------------LNLISKLFCSGT--
G3QTJ6_HRK-01           AAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQV
                                                                          

A0A2I2Z168_BMF-02       RLFYAPAEPKSCVVADPPL-------PAQPCFEWRREQERGRP-------
A0A2I2Z168_BMF-01       RLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQ
A0A2I2YVQ5_PMAIP1-      NLTASKTCMRGLL--QKSFLRRCTFHQFEERLHCNWEECEGAFMGAL---
A0A2I2YQ13_BCL2L11      SLLSRSSSGYFSF--DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVRE
A0A2I2YQ13_BCL2L11      SLLSRSSSGYFSF--DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM---
G3QCT2_BIK-01           AMHSLGLAFIYDQTEDIRDVLRSFMDGF------------TTLKENIMRF
A0A2I2Z8C7_BAD-03       SLPVLVGSELGQG--KLRPLPVTFA-------AHPETPPVPTALGSHLEY
A0A2I2Z8C7_BAD-01       APPNLWAAQRYGR--ELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSW
A0A2I2Z8C7_BAD-02       APPNLWAAQRYGR--ELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSW
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
G3QTJ6_HRK-01           AALAAWLLGRRNL-------------------------------------
                                                                          

A0A2I2Z168_BMF-02       -----------------------------------------
A0A2I2Z168_BMF-01       FHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR
A0A2I2YVQ5_PMAIP1-      ------------------------------GNGRWNTSK--
A0A2I2YQ13_BCL2L11      IEEVVV-----------------------------------
A0A2I2YQ13_BCL2L11      --GIFE-----------------------------------
G3QCT2_BIK-01           WRSPNPGSWVSREQVLLALLLLLALLLPLLSGGLHLLLK--
A0A2I2Z8C7_BAD-03       GRKYFPQAYAKRGSV----------LSPLEGRLTQIPFRCV
A0A2I2Z8C7_BAD-01       TRVF--QSWWDRNL----------------GRGSSAPSQ--
A0A2I2Z8C7_BAD-02       TRVF--QSWWDRNL----------------GRGSSAPSQ--
A0A2I2YVQ5_PMAIP1-      -----------------------------------------
G3QTJ6_HRK-01           -----------------------------------------
                                                                 

© 1998-2020Legal notice