Dataset for protein classical BH3-containing proteins of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

20 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2YVQ5_PMAIP1-      -------MPGKKARKNAQPSPARAPAELEVEC------------------
A0A2I2Z168_BMF-02       --MEPSQCVEELEDD--VFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSR
G3QTJ6_HRK-01           ---------------------MCPCPLHRGRG------------------
G3QCT2_BIK-01           MSEVRPLSRDILMETLLYEQLLEPPTME----------------VLGVTD
A0A2I2YFH2_BAD-03       MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
A0A2I2YFH2_BAD-04       MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
A0A2I2YFH2_BAD-02       MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
A0A2I2YFH2_BAD-01       MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
A0A2I2YVQ5_PMAIP1-      -------MPGKKARKNAQPSPA-RAPAGPAGTARDQAGFGIEMQLRFTRG
A0A2I2Z168_BMF-01       --MEPSQCVEELEDD--VFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSR
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGA------------------
                                                 .                        

A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I2Z168_BMF-02       LQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEP----
G3QTJ6_HRK-01           ----PPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSR
G3QCT2_BIK-01           SEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVA
A0A2I2YFH2_BAD-03       QQEQPTSSSHHGE--------------GTSSPEERRHSNADAAKLQLDAS
A0A2I2YFH2_BAD-04       QQEQPTSSSHHGG---------RTSYSPSWESED--SENPSAGMLAEASA
A0A2I2YFH2_BAD-02       QQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSA
A0A2I2YFH2_BAD-01       QQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSA
A0A2I2YVQ5_PMAIP1-      KKLLSSSPLALPRGHEEQVQVAGSRVC--YSTQEIWRQTELPAETSESDI
A0A2I2Z168_BMF-01       LQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR--
A0A2I2Y4B3_BCL2L11      ----PTSLQTEPQ-------------------------------------
A0A2I2Y4B3_BCL2L11      ----PTSLQTEPQ-------------------------------------
A0A2I2Y4B3_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSP
A0A2I2Y4B3_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSP
A0A2I2Y4B3_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSP
A0A2I2Y4B3_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSP
A0A2I2Y4B3_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSP
A0A2I2Y4B3_BCL2L11      ----PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSP
A0A2I2Y4B3_BCL2L11      ----PTSLQTEPQ-------------------------------------
A0A2I2Y4B3_BCL2L11      ----PTSLQTEPQ-------------------------------------
                                                                          

A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I2Z168_BMF-02       -----------------------QRLFYAPAEPKSCVVADPPLPAQPCFE
G3QTJ6_HRK-01           R----------------------APAPGALPTYWPWLCAAAQVAALAAWL
G3QCT2_BIK-01           M----------------------HSLGLAFIYDQTEDIRDVLRSFMDGFT
A0A2I2YFH2_BAD-03       L----------------------PVLVGSELGQG--KLRPLPVTFA----
A0A2I2YFH2_BAD-04       G----------------------MSAPAADSEAQ--HAENVKLEALGLW-
A0A2I2YFH2_BAD-02       P----------------------PNLWAAQRYGR--ELRRMSDEFVDSF-
A0A2I2YFH2_BAD-01       P----------------------PNLWAAQRYGR--ELRRMSDEFVDSF-
A0A2I2YVQ5_PMAIP1-      QTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNWEECEG--AFM
A0A2I2Z168_BMF-01       ----------LFYGNAGYRLPLPASFPAVLPIGE-----QPPEGQWQH--
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      -----------------------DRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2Y4B3_BCL2L11      LFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2Y4B3_BCL2L11      LFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2Y4B3_BCL2L11      LFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2Y4B3_BCL2L11      LFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2Y4B3_BCL2L11      LFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2Y4B3_BCL2L11      LFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2Y4B3_BCL2L11      -----------------------DRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A2I2Y4B3_BCL2L11      -----------------------DRSPAPMSCDKSTQTPSPPCQAFNHYL
                                                                          

A0A2I2YVQ5_PMAIP1-      --------------------ATQLRRFGDKLNFRQKLLNLISKLFCSGT-
A0A2I2Z168_BMF-02       WRREQERGRP----------------------------------------
G3QTJ6_HRK-01           LGRRNL--------------------------------------------
G3QCT2_BIK-01           TLKENIMRFWRSPNPG------SWVSREQVLLALLLLLALLLPLLSGGLH
A0A2I2YFH2_BAD-03       ------AHPETPPVPTALGSHLEYGRKY--FPQAYAKRGSVLSPLEGRLT
A0A2I2YFH2_BAD-04       --RSGVA---TAPTPRGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAA
A0A2I2YFH2_BAD-02       --KKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ-----
A0A2I2YFH2_BAD-01       --KKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ-----
A0A2I2YVQ5_PMAIP1-      GALGNGRWNTSK--------------------------------------
A0A2I2Z168_BMF-01       --------------RAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQI
A0A2I2Y4B3_BCL2L11      ---ASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKLLASST---
A0A2I2Y4B3_BCL2L11      SAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDH
A0A2I2Y4B3_BCL2L11      SAMGIFE-------------------------------------------
A0A2I2Y4B3_BCL2L11      SAMANWD-------------------------------------------
A0A2I2Y4B3_BCL2L11      SAMVREIEEVVV--------------------------------------
A0A2I2Y4B3_BCL2L11      SAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDH
A0A2I2Y4B3_BCL2L11      SAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRMPLPPD------
A0A2I2Y4B3_BCL2L11      SAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK---------
A0A2I2Y4B3_BCL2L11      SAMVVILEDIGDLSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS------
A0A2I2Y4B3_BCL2L11      SAM----DDSAGSSLRIAL--------------------HREVQWPLEWL
                                                                          

A0A2I2YVQ5_PMAIP1-      ---------------------
A0A2I2Z168_BMF-02       ---------------------
G3QTJ6_HRK-01           ---------------------
G3QCT2_BIK-01           LLLK-----------------
A0A2I2YFH2_BAD-03       QIPFRCV--------------
A0A2I2YFH2_BAD-04       SSGG-----------------
A0A2I2YFH2_BAD-02       ---------------------
A0A2I2YFH2_BAD-01       ---------------------
A0A2I2YVQ5_PMAIP1-      ---------------------
A0A2I2Z168_BMF-01       LLFLHNLALNGEENRNGAGPR
A0A2I2Y4B3_BCL2L11      ---------------------
A0A2I2Y4B3_BCL2L11      PRMVILRLLRYIVRLVWRMH-
A0A2I2Y4B3_BCL2L11      ---------------------
A0A2I2Y4B3_BCL2L11      ---------------------
A0A2I2Y4B3_BCL2L11      ---------------------
A0A2I2Y4B3_BCL2L11      PRMVILRLLRYIVRLVWRMH-
A0A2I2Y4B3_BCL2L11      ---------------------
A0A2I2Y4B3_BCL2L11      ---------------------
A0A2I2Y4B3_BCL2L11      ---------------------
A0A2I2Y4B3_BCL2L11      AKSS-----------------
                                             

© 1998-2022Legal notice