Dataset for protein classical BH3-containing proteins of organism Gorilla gorilla gorilla

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----mppfspseqeesssaqpglgppptgpgpsgsg----qa---lld-slsqeqptplshhggeglsptssrhsaylap
mmfqi-e-e-----d----er-eresvlrr-sptp-khhr--pgl---alhqeptlnssgnfcdpldveprqspqstqtl
 ake-s-v-svcer-grvl--edm gqaqdkall-adlfassgtrgwrcpqtrllafretrcesatarrihgedkgrp-g
  s pedsqcekdlqddqfrqa-e ctma-d-a-fsverqprfr vkkvtsev dglqrrdldqvqvqcsmw----p-r-
    vrglkrrinm tlpy apmc akkh  r-q  pcmcl      gsedas c d mkae elesmgqkvcyrt-siw
       k ad la p l   la   g e  qgp  iaa         l a     a  e    k nf geraranqe r
                               n                                g ha e l l lad c
                                                                  c    d       a
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-pdpgpqgtrsplfvtrsrsalpslwasgrysl--dlrr----f---f----p-p-----at-l----------------
t-a---mavmpsplrgmrpvsplyrssaqyggrva----vprp-vds-stql-s-peqgt--y-sassswtrvffvqsww
se-spsl-lel-cgifll-qr-fna-l---f-fteetppssdemscpkkkgtqrrksaafnrqmrqmvrywhsyvpgqyv
paseegfse--k--cseeq--m-a-v-lyl-q-p spdlmlattmqdpeprwhhnwcvqvghpkgsimeqiervne ahq
rqtdmd-p-yw wiqqqtlrnat-sptgpkspv  qksflrvsgfhqaqgcfew rtpprtal qnlldfg kph    a
ig  lavn se r klgaea  hvgngemirnq  ki d  pi e g  e  ac e eeip k echa ef gl      
a     ae ia d aaa d      k cf llg   f a   c a          a  ce  f         ei      
                         g  e  d                              a                 
                               c                                                

       170       180       190 
....:....|....:....|....:....|.
                               
-------------------------------
drnlvvwwqllllllllplngrgssnpsqpv
snqsrllali  fahnsa lsnltwatlkcr
q gq               e gerrllfr  
k en                 e nqigag  
                       lh      
                               
                               
                               
© 1998-2020Legal notice