Dataset for protein classical BH3-containing proteins of organism Gorilla gorilla gorilla

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         .                                                      
makqpsdvssecdregrqlqpaerpPqlrpga----------------------ptslqtepqg-p----------cp-g
--qi-efepgkqedsssaerglgpstagdgpsgsgkhhrqapgllwdashqqeq-ltsshhgg-n-egnhggegds--h-
 f--r--mve-la-k--vps-edgeavtq---llsadlfaqslqdcpltrlklfs--hccg--lraveqssaatsylapt
 sme pqc--ik-edna-f-lm-ac mh-vrtardqag giem vrgvrgse llsp--a-ssagltsirdrhsqtpsga
  ev  l-rd -m -lly-   r a lepaeg             lft dk  d pavl-ldr hemqvevkrqlvsgty
       s      t       c   e e  c                       d pedf e ecglrq  larra sw
                                                         m  c a     g   g     rs
                                                                              cl
                                                                               i
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
spqg--appaspgpfa-rs------------------------drspapmscdkstqtpsppcqafnhylsamasmr---
----pl----------t--plfifmrrssllsrsssgyfsfdtpsl--a--yg-----r----ef---f--------qae
edeegvslnpgvtrlrssvaptlll nltaskygnr lrqpsp---wg-qr--rtwhl-rvsv--vds-twrrvnlprpk
ktsqdmmeectafegpeedsr          ftcma  llklfanavyvlpeyqrlecadmqltqlqawmtlkkgiaedw
gsdmrwgstrpramesqdarq                      qvrgtspqtqepevvnwlldsgwpl elglgvemwrv
 aldirrqrelmwktqla im                      mpfflfhlipw clieqekrp qgg  g  erwlhnt
     elhq d larla   g                      l  c  figeg  ka paeeg mac     sqvigfs
      h       q                            h     eafa   d  n   a a       rigedep
                                                 d         a               fd  i
                                                                                

       170       180       190       200       210       220 
....:....|....:....|....:....|....:....|....:....|....:....|.
                                                             
-a-----------l-r----f------r---------------------------------
p-dmrpeiwiaqe-r-igde-nayyar-gslnpsqsaelhprmvilrllryivrlvwrmhr
svptptqmrqstswtsvfqswwqrnlqlvpklnylaggdtllssrnva ngeenrngagp 
tsgslrivqttsgyglyyhvlsdltvlqnlssvqwvwwwlssplhcl              
vpsvawgrlshrq vcspaqhprarkg lhvaslsptrtiqklk                 
rkln gflg flk q re p lfdqek pftpqpresmqaaigg                 
gg   aagf  k  d ka k h  l   mqrelnhcl a   ff                 
ad     a        f  h g  h   heqdkdf                          
                            aai ga                           
                                f                            
© 1998-2022Legal notice