Dataset for protein iridoviridae of organism Rana tigrina ranavirus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRAFAHLYTMLWEGVNLEEVHASLLRDGVVNWGRVAAFMHICRYIVRTFPS
                                                                                

        90       100       110       120       130       140         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
****************************************************        *********
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGKCLEWLGAGVITGVIT--------GVILSLLFS
                                                    gvitgvit         
© 1998-2021Legal notice