Dataset for protein 097R of organism Epizootic haematopoietic necrosis virus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MGVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGIVNWGRVAAFMHICRYTVRTFPS
                                                                                

        90       100       110       120       130       
....:....|....:....|....:....|....:....|....:....|....:..
****:****************************************************
SMDRtEVALTKFIQDPKIDEHLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFS
    a                                                    
© 1998-2021Legal notice