Dataset for protein BALF1 of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                      *. :::**:***.***:**::* .**:.***:***:******
mnlaialdsphpglasytilprpfyhislkpvswpdet kqtet  a   k   d  is lt  nr   t   l      
  r  t  fh                      n       a                    s                  

        90       100       110       120       130       140       150       160
**:.**..** ** ****  ** *.**. **:.***.***: .  :**.:* *:* *:*:** ************:****
  aq  tn  t  q    xx  x k  kr  tk   k   vrdxha  qi t i c l d  c            a    
  s   sg     m              e   d                                             

       170       180       190       200       210       220
*****.** ******** ********* **.*:**:* **. .*** *::*.*: *****
     n  e        t         v  v m  l i  kcr   r tm g sy     
     g  r                  p    i                i          
© 1998-2023Legal notice