Dataset for protein BALF1 of organism Epstein Barr virus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      *.*:*:**:***.***:**:** .**:.**************
--------------------------------------MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
mnlaialdsphpglasytilprpfyhislkpvswpdet k t t  a   k   d  i  lt  nr              
  r  t  fh                      n                            s                  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:***.:**********  ** ***** **:.*******: . ****.:***:* *:**********************
VFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
  a   tn          xx  x     r  tk       vrdx    qi   i c l                      
                            e   d                                               

       170       180       190       200       210       220
....:....|....:....|....:....|....:....|....:....|....:....|
*****.********************* **.****** *** .*****:***********
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
     n                     p  v      i   cr     t           
     g                     i                                
© 1998-2022Legal notice