Dataset for protein BALF1 of organism Epstein Barr virus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      *. :* **:***.***:**:** .**:.**************
--------------------------------------MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
mnlaialdsphpglasytilprpfyhislkpvswpdet kqt t  a   k   d  i  lt  nr              
  r  t  fh                      n          c                 s                  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:***.:**********  ** ***** **::*******: . ****.:***:* *:**********************
VFtRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
  a   tn          xx  x     r  td       vrdx    qi   i c l                      
                            e                                                   

       170       180       190       200       210       220
....:....|....:....|....:....|....:....|....:....|....:....|
*****.********************* **.****** **. .*****:***********
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
     n                     p  v      i  kcr     t           
     g                     i                                
© 1998-2020Legal notice