Dataset for protein adenoviridae of organism Simian adenovirus 3

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
         .**..* :  .:    :*..: .  :                                             
meradaaqmd  eg edamplerlle aedatraiggeasvsapaasasssaaeaggsgshfgggerhgreesesgagps

        90       100       110       120       130       140       150       160
             : :*:  .  : *          ****: .   * :                * :::.:: *   **
gggvggipdpfpefaf apggaflv edeegrqrgq    feefdf adqtvalmaknrlevvwl elfddfek dlh  

       170       180       190       200       210       220       230       240
*:  * *:.                                                                       
 erl e ldtywmnpdedwevvlnrygkvalrpdcryqvrdkvvlrrnvyllgngatvemvdprrggfvanmqemcpgvv

       250       260       270       280       290       300       310       320

       330       340       350       360       370       380       390       400
                          :.. **:*  :                             :. *   **     
ctlgissegflhagdnvasdngcaflfkgg  i halacgpgdvppkpyqmvtctdgkvrmlkpvhfag lld  neqtq

       410       420       430       440       450       460       470       480
  * :  :.:* *   :* ***                      .  :* :.:         *: . * .          
ls efehdfl l llkf g   vfmprqcnlahcnvimeqsaatqkcf gifdismvvykil hddc aqrrtcdcgash

       490       500       510       520      
         :  :* * . : ..: ** *. :*::           
lcnltvmgmlqae l dhcdheair  e gmd edpragldppaee
© 1998-2022Legal notice