Dataset for protein E1B 19K of organism Human mastadenovirus E

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
** .. :::                                                                * : ..:
MEiwtvled----------------------------------------------------------------Fyktrql
  srnpfqqglpagflsssfvenmevpapecnlrllagtaarhsedpespaaggsrresesrpgpsgggvadl helhrv
                                                                          p     
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* .:*.*                             . :*                 **.:                   
LenaSnG----------------------------vsylW-----------------RFcfgg-----------------
 trs s rergikrerhdetnhrieltvglmsrkrpetv wyevqstgtdevsvmhe  sleqvktcwlepeddwevair
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: ***. *....*.  :: :* . *                           **                          
dlAKLvyRtkqdYk-eqfddIlkeC---------------------------PG--------------------------
ny   al adrk ritklen rra yisgngaeveiclqdrvafrccmmnmy  vvdmdgvtfmnmrfrgdgyngtvfma
        p         i   n                                                         
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                    **:  :**  *  : ** .. .  *   
----------------------------------------------------LFdalnLGhqShfnqRIsraldftT---
ntkltvhgcsffgfnntcieawgqvgvkgcsfsanwmgvvgrtksmlsvkkc  erch  vm egea  rhcaste gcf
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                ..  *** . :.  . *.:  *                 :. : :*::
-------------------------------pgrttAAVaffafvldkWsqetH-----------------fsrdyqLdf
vlckgnakikhnmicgasdergyqmltcaggnshml   hvashifkp pefe nvmtrcnmhlgarrgmfmpyqcn ny
                                            sr                                  
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: * *                   .**  * :                                                
laVaL-----------------wraWKcqRlnaisgycrysr--------------------------------------
vk l epdvmsrvsltgvfdmnvet  il ydeypatlpvqpldtlrilslqqvsvevtrrqqqqedqeenpragldppa
                        v         ---  ace cggkharf picqdrqedlrpdhlvlsctgtefgssg
                                  ktr                                           

    
....
    
----
eese
  ed
    
© 1998-2022Legal notice