Dataset for protein adenoviridae of organism Human mastadenovirus B

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
   adpf        r h i             k    t frc gnp as g    fa  tpr  p        g     
   t                                      r        c                            

        90       100       110       120       130       140       150       160
                                                    *  ::.  .    : . . .:. ..  *
adlfpelrrvltrsttsgqnrgikrernpsgnnsrtelalslmsrrrpetvw hevqsegqdelsilnekysleqfktc 
   s   q    g  st rd  v    as  tda s              i      k kk  q v d          
                                 p                k      n         s            

       170       180       190       200       210       220       230       240
:  :          *.: :* .: *       : :.      *    ::   .. :.             :.::.::.  
lggdddwevairny klsl pdkq ketkkinidnscyisgn aeviidtqdkvairccmmgmwpgvvgmeavtlmnirf
 as        k    va     l sqsrr   v c          v   p rtv      d            fv
                          v      l                                              

       250       260       270       280       290       300       310       320
 *    .:.*::                  .: *    :    *   ::                               
r dgyngiv mantklilhgcsffgfnntcvea gqvsvpgcs ykcwiatsgrvksqlsvkkcmfercnlgilnegear
k                           i f              r     a  t     l   i q             

       330       340       350       360       370       380       390       400
                                                   .:.:  ...* .                 
vrhcaatetgcfilikgnasvkhnmicghsderpyqmltcagghcnilatvhvvaharkk pafehnvitkctmhiggrr
is   ssd           n        a n               m       t q      ld   l      a    
       q                    p                           p           m      v    

       410       420       430       440       450       460       470       480
          ..:..:*   ... :.::*::                             *. *.   * :: . :    
gmfmpyqcnmnrvkvm dpdafsrvslt mfdmniqlwkilryddtkprvracecggkha fq tcvd tqdlrpdhlvl
  l        k   l g      m         t i         rs   t            a  s     h     i
           n     n                m                                             

  . . :... **   
actgvefgssg  aee
 r           -- 
© 1998-2022Legal notice