Dataset for protein adenoviridae of organism Human mastadenovirus A

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
                                                              :**..:::* .*    : 
rerkeslketvlnrltvnlmsrprletvywqelqdefkqghmhlqykysfeqlkthwlepwed  aaika ak allldc

       170       180       190       200       210       220       230       240
* * :                                                      . *.  :* :. * *:* *  
 s isktvtitsctyiigngavvevdtsdrvafrcrmqgmgpgvvgldgitfmnvrfageg kgil eanl k l g ke

       250       260       270       280       290       300       310       320
 *  :*:*  .:* . ::: .  .:. ::  * *. .  *  . : . ..** :::                        
d fee e icad pgklaaldccfhgcfkal g pkdfm sgkclaeiaf  lildgdahirhnaasentcfillkgmai

       330       340       350       360       370       380       390       400
                               :  ..:. .*       :*   : : *.*. :.   * :* :.      
lkhnmvcgvsdqtmrrfvtcadgnchtlktvhisehahlc dvcdhnmf lctialg r avfkprq if hanvmlepe

       410       420       430       440       450       460       470     
                                                          **:. *. : :.:  ::
afsrvslngvfdlsvelckiiryddaarhrcrqcecgsshlelrpvmlnvteelrsdh  lpc qedqensdede
© 1998-2022Legal notice