Dataset for protein E1B 19K of organism Human adenovirus F serotype 41

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
merpnpsvggvysglhdngpvenpaaeeeglrllagaasarsgssaggggggggggepegrsgssngivtepdpeegtss
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                 :*::*:              .::.*.              .::  .:
-------------------------------MEFWSELQ--------------SYQSLR--------------RLLELAS
gqrgekrklendgadflkeltlslmsrcypesvw ad edefkngnmnllykygfeq kthwmepwedwelalnmfakva
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *..: : :    .: :  *   :.   .*         . : *:.**:       * .:.:.  .*  ::. .. ::: 
ARTSSCWRFIFGSTLTNVIYRAKEDYSSRF---------AELLSFNPGI-------FASLNLGHHSFFQEIVIKNLDFSS
l pdtiytikktvnirkca vigngavvq qtfdrvvfncamq lg  vigmsgvt nnvrfaadg ngkvfasttqltl
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *                                                             *  :*   :  :     
PG-------------------------------------------------------------RtVSGlafICFiL----
h vffqncsgvcvdswgrvsargctfvgcwkglvgqnksqmsvkkcvfercilamvvegqari hna vgnvwcvclkgt
                                                                  sel   l     
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        ..  *               : . *  ::           
-------------------------------------dQWSAqTH---------------LSEGYTLDY-----------
asvkhnmicgtghsqlltcadgncqtlkvihvvshqrrpepvye nmlmrctmhlgarrgmfsp qsnfchtkvlmetda
                                     i                                        
                                                                                

       410       420       430       440       450       460       470    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
           :*: *:..:   :    * *.:         *  *: .         :  .            
-----------MTMALWRTLLRRKRVLGCSPAQP--------PHGLDPvr---eeeeEEeeENLRagldpqtEl
fsrvwwsgvfdl ie ykvvrydelkar r cecganhirly at nvtveee----hqmrsc-----------
                                                 e  qrrtd  gl    tdyessd d
                                                     l                    
© 1998-2022Legal notice