Dataset for protein adenoviridae of organism Human adenovirus D serotype 8

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                           k v                  

        90       100       110       120       130       140       150       160
  :* *:  *:.*     :* :  : *** .                                 *: . .:*    .  :
lne s lyp ls vltsma gvkrer   gntglmtqltaslmnrkrperitwhelqqecrdei lmqdky leqikthw

       170       180       190       200       210       220       230       240
   .:  **  : :*      **.  : .::*: * .                             ::: . :  :::. 
lnpdedw  aikly kialrp  kygvtktv ik acyisgngaevdidtldksafrccmmgmragvmnmnsmifinikf
            i            c                                                      

       250       260       270       280       290       300       310       320
 * .  ** *:.      ..   *    ::.*  *   :* *  . ** .: . *:                        
n ekfn  l ma------nshmt hgcsffg nn caev g -aki  ckfygc mgvvgrpksemsvkqcvfekcylgv

       330       340       350       360       370       380       390       400
                                           : ..  *: *: .:                       
ctegnarvrhcssletgcfclvkgtasikhnvvkgctdermynmltcdl vc ilknihvtshprkkwpvfennllikch

       410       420       430       440       450       460       470       480
                      :**::  . :: *   .:*                                       
mhlgarrgtfqpyqcnfsqtkll  ndafsavnl gifdm vsvykilrydetksrvracecggrhtrmqpvaldvteel

       490       500  
              ..  *: *
rpdhlvmactgtefsslg dt 
© 1998-2022Legal notice