Dataset for protein adenoviridae of organism Human adenovirus C serotype 5

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                                          *:. : 
merrnpsergvpagfsghasvesgcetqespatvvfrppgdntdggaaaaaggsqaaaagaepmepesrpgpsg nvvqv

        90       100       110       120       130       140       150       160
 * :. :*.:*  :.:. .     *.* .. . .*  .*: .                *::: ..*.: :* *   :  :
a lypel ri titedgqg----- k vkrerga eat earnlafslmtrhrpecit qqikdn anel l aqkysie

       170       180       190       200       210       220       230       240
 *   .:    **. . *. *                                      *** . : : *.    :.*  
q ttywlqpgd  eeai vy kvalrpdckykisklvnirnccyisgngaeveidtedr   rcsminm pgvlgmd vv

       250       260       270       280       290       300       310       320
:::.                 * :*                            *..** * *.*                
imnvrftgpnfsgtvflantn il gvsfygfnntcveawtdvrvrgcafycc kg  c p s asikkclferctlgil

       330       340       350       360       370       380       390       400

       410       420       430       440       450       460       470       480
 *.. * .::* :   .: :                                           .. *::    :    * 
h gnr gvfl yqc-lshtkillepesmskvnlngvfdmtmkiwkvlrydetrtrcrpcecgrkhi nqpvmldvtee r
              n   e                                          ag                 

       490       500 
© 1998-2022Legal notice