Dataset for protein adenoviridae of organism Human adenovirus C serotype 2

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                              *:
------------------------------------------------------------------------------Me
merrnpsergvpagfsghasvesggetqespatvvfrppgnntdggaaaaaaaaggsqaaaaagaepmepesrpgpsg n
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. :  * :. :*.:*  :.:. .     *.* .. . .*  .*: .                *::: ..*.: :* *   
aweclEdfsavRnlLeqssnstswfwrfLwGssqaklvCrikEdyk--------------weFeellksCgelfDsLnlg
vvqva lypel ri titedgqg----- k vkrerga eat earnlafslmtrhrpecit qqikdn anel l aqk
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:.                    :: : .:.                         :::.* .*    *** . : : *. 
hqa-------------------lfqekvik------------------------tldfsTpgRaaaaVAFlsfikdkWse
ysieqlttywlqpgddfeeairvyakvalrpdckykisklvnirnccyisgngaeveid ed ----   rcsminm pg
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :.*  :::.                 * :*                            *..** * *.*        
ethlsGgylldf-----------------LamH---------------------------lWraVV-RhKnRl-------
vlgmd vvimnvrftgpnfsgtvflantn il gvsfygfnntcveawtdvrvrgcafycc kg  c p s asikkclf
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
erctlgilsegnsrvrhnvasdcgcfmlvksvavikhnmvcgncedrasqmltcsdgnchllktihvashsrkawpvfeh
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       * *.. * .::*                                      :*     .  * . .. *::   
-------LlLssvRpaiiP-------------------------------------teE-----qqqEearrrrRqeqsp
niltrcs h gnr gvfl yqcnlshtkillepesmskvnlngvfdmtmkiwkvlryd trtrqrpc cggkhi nqpvm
                                                           qqqqc                

       490       500         
....:....|....:....|....:....
 :    * *                    
wnpragLdPre------------------
ldvtee r dhlvlactraefgssdedtd
                             
© 1998-2021Legal notice