Dataset for protein adenoviridae of organism Human adenovirus C serotype 1

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*    *  .. :           : ::*  .   ..                                            
MrhwiClggvit-----------vrnvLeqssnstswf-----------lvcrikedykwefeellkscgelfdslnlgh
 eaie hedfsaeemaaslldqlieel adnlpppph-wrflwgssqakepptlh-l-dldvtapedpne-avsqifpds
          f                 cl  sls            ------ - ------------ ---------
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .   :   **                                                             
qalfqekviktldf-stPG----------------raaaavaflsfikdkwseethlsg------------gylldflam
vm-aaqeg-dlrtlppa  spepphlsrqpeqpeq--lgp-smpnlvpevidltc-ea-fppsddedeege---------
-- ----- qn n qdl                    --- -------------- --             efv  yveq
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------hlwravvrhk------------
pghgcrschyhrrntgdpdimcslcymrtcgmfvyspvsepepepepepeparparrpkmvp-il-rptspvsrecnsst
                                                          ---- -- --            
                                                                                

       250       260       270       280       290       300      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
                ::  . :                                           
--------------nrvlllssvrpaiipteeqqqqqeqqe----rrrrrqeqspwnpra------
dscdsgpsntppeihplvpwcpik-vavrvggrrravqci-ellnepgqpldl-ckr--pgldpre
              --   lls ---------------qdear-------- ---  -      
                                      ea  a                       
© 1998-2021Legal notice