Dataset for protein adenoviridae of organism Human adenovirus B serotype 7

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------mevwailedlrqtrllle---------------------nasdgvsglwrfwfgGdlarl
mdppnslqqgirfgfhsssfv-nmegsq-ednl---asaasrssrdtetptdhasgsagg-ag-q-esrpgps--gv-d-
                    - ------ ----k  --   g         y       -s--f-g-------t --p-w
                                    m                         s e  vfspyl  r  p 
                                                                       c        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
vfrikqdytvefekllddspglfealnlghqahfkekvLSvl-----------dfstpgrtaaavafltfildkw-----
fpelrrvlsrstts--gqnr-ikrer-psgnnsrt-la--lmsrrrpetvwwhevqse--devsilqekys-eqlktcwl
--------------tv---- -----q--------y--  --           -----aa----------- ---     
a gv  nvre mg    gr      v  ansstl  at  ss           pldaa  a  ta               
                  i                                                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------irqthfskGyvldfiaaalwrtwkarrmrtilgywp-------------
epeddwevairnyakislrpdkqyritkkin--nacyis-ngaev-idt---qd--afrccmmdm--gvvgmeavtlmni
                                a------ -----v---sss--ps-------n-ll       i     
                                   ilgm  ygsi  ns   nn  tlaedk -v               
                                                               l                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rfrgdgyngivfmantklilhgcsffgfnntcveawgqvsvrgcsfyacwiatsgrvksqlsvkkcmfercnlgilnege
                       r        e                                               
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
arirhcaatetgcfilikgnasvkhnmicghsderpyqmltcagghcnilatvhivsharkkwpvfehnvitkctmhigg
  v        a                                                                    
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------vqplgvagilrhpptmpavLqeeqqednprA--------------------------
rrgmfmpyqcnmnhvkvmlepdafsrvslt--fdmniqlwki-ryddtkprv--cecggkharfqpvcvdvtedlrpdhl
                       -------qr---------- ---------t                           
                       a lea     gelskqv q   qtesava                            
                                                                                

       490       
....:....|....:..
                 
---------gldppvee
vlactgaef-ssgeetd
         k-------
           k     
                 
© 1998-2022Legal notice