Dataset for protein adenoviridae of organism Human adenovirus B serotype 7

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------mevwailedlrqtrlllenas---------------------dgvsglwrfwfgGdlarl
mdppnslqqgirfgfhsssfv-nmegsq-ednl---asa--rssrdtetptdhasgsaggaag-q-esrpgps--gv-d-
                    - ------ ----k  ---  g         y     ms s -f-g-------t --p-w
                                                              s e  vfspyl  r  p 
                                                                       c        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
vfrikqdytvefek--ddspglfealnlghqahfkekvlsvl-----------dfstpgrtaaavafltfildk----wi
fpelrrvlsrsttsllgqnr-ikrer-psgnnsrt-la--lmsrrrpetvwwhevqse--devsilqekys-eqlktc-l
--------re----  ---- -----r--------t--ya-- sspldaaaaa-----an-----------v--ssssn-
agvrqn m--tvdg    i         vqp nss  t  t            aataa   ilgmgyygs  an     n
        gs                                                                      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rqthfskgyvldfiaaalwrtwkarrmrti-----------------------------lgywp----gvag--------
epeddwevairnyakis-rpdkqy-itkk-nirnacyisgngaeviidtqdkaafrccmmdm--vqpl--v-meavtlmn
-----------------a------e----v                             ---        -    i    
ps laedkllvll qle ltqrlg ls q                               n                   
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
irfrgdgyngivfmantklilhgcsffgfnntcveawgqvsvrgcsfyacwiatsgrvksqlsvkkcmfercnlgilneg
                        r        e                                              
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
earirhcaatetgcfilikgnasvkhnmicghsderpyqmltcagghcnilatvhivsharkkwpvfehnvitkctmhig
   v        a                                                                   
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------ilrhppTmpaVlqeeqqednpr----------------
grrgmfmpyqcnmnhvkvmlepdafsrvsvtgifdmniqlwk---ydd-k-r-rac-cggkha-fqpvcvdvtedlrpdh
                             l            aql--- -s- ---k------                 
                                             req e   ata sk                     
                                                                                

       490        
....:....|....:...
                  
---------agldppvee
lvlactgaef-ssgeetd
         - -------
                  
                  
© 1998-2022Legal notice