Dataset for protein adenoviridae of organism Human adenovirus B serotype 3

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    :*     :*  : .** . **                                 .**:.*
--------------------vEvweisqDlrqtrLLlsnAS---------------------------------gGVsgL
mdppnslqqgirfgfhsssfm nmagle ednlk  aea  gssrdtetptdhasgsaggaaggqsesrpgpsgd  ad 
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:                                               :*.                             
wr----------------------------------------------wWhg----------------------------
fpelrrvltrsttsgqnrgikrernpsgnnsrtelalslmsrrrpetvf fevqsegrdevsilqekysleqlktcwlep
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         : *.: :* .::**               :  * ::* :. . * .  :* . . .  :.::::::   * 
--------rnyArlvlRpkqqYR---------------ngfEvllD-qspglFrclnmG-wqgvvkmkvvtvmnistpGr
eddwevaigdl kisf idkd  itkkinirnacyisgeea kii tddkav eacml mhpahfgeealslldfrfr d
                                                   a                         k  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .:.*::                  :: *    :*   *   ::                                  
tyngvvFmt----------------tivekW----vRqtsFykgyvlt--------------------------------
gaaaia lantklilhgcsffgfnnfclda gqvsi gch sacwiadsgrvksqlsvkkcmfercnlgilnegearvrh
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                .*.:  ...*                      
------------------------------------------------hIvshlwrtW----------------------
caatetgcfilikgnasvkhnmicghsderpyqmltcagghcnilatvf aaaarkk pvfehnvitkctmhiggrrgmf
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     : ..:..:*:  ... :.::**:     :  :*. :: : . **                               
-----nmrrvrvmLeywpvsrvsvtGIlrmpptmwkvLryeqtkprvRA-------------------------------
mpyqckanhmkti dpdafqplgla  fdhniqlpai qeddqednp  cecggkharfqpvcvdvtedlrpdhlvlact
                                                                                

       490  
....:....|..
    * .    :
----Gssppvte
gaef ldgeeed
            
© 1998-2020Legal notice