Dataset for protein E1B 19K of organism Human adenovirus 68

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                            *  :
--------------------------------------------------------------------------mgVwdl
mdppnplqqgirfgfhsssfvenmegsqdednlrllasaasgssrdtetptghasgsgggaaggqsesrpgpsgge aai

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: :**  *:*  .:*.* .                               :*.                         *:
lpeLR--RvLtrstSsGvsr------------------------------wWr------------------------fWl
fed  qt l lena d qdggikrernpsgnnlrtelalslmsrrrpetvf hevqsegrdevsilqekysleqlktc f

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :          *.: :* .::**   :  : ::      *    ::   :* *.             :.::.:::   
gpe---------yArlvlRpkqqYRitkkknlrns-----pGlfvilntqhqAhFr------------mkvvtvmnistr
egdddwevairnl kisf idkd  eefeiliddacyilgn aeeaidlgdk a kccmmgmwpgvvgeealsfldfrfp

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*    .:.*::                  :: *    :*   *   ::                                
GrtyngvvFmt----------------tivekW----vRqtsFykgyvlt------------------------------
 dgaaaia lantklilhgcsffgvnnfclda gqvsi gch sacwiadsgrvksqlsakkcmfercnlgilnegearv

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                  .*.:  ...*                    
--------------------------------------------------hIvshlwrtW--------------------
rhcaatetgcfilikgnasvkhnmicghsderpyqmltcagghcnilatvf aaaarkk pvfehnvitkctmhiggrrg

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       : ..:..:*:  ... :.::**:     :  :*  :: : . **                             
-------nmrrvrvmLeywpvsrvsvtGIlrmppqmwkvLryeqtkprvRA-----------------------------
mfmpyqckanhmkti dpdafqplgla  fdhnialpai eeddqednp  cecggkharfqpvcvdvtedlrpdhlvla

       490    
....:....|....
      * .    :
------Gssppvte
ctgaef ldgeeed
© 1998-2020Legal notice